KEGG   Micrococcus luteus: Mlut_14860Help
Entry
Mlut_14860        CDS       T00918                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mlu  Micrococcus luteus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mlu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626452..1627441
Genome map
AA seq 329 aa AA seqDB search
MPTPSVPLVHPVHRFAHQEIDFRRRIVTMAVVNRTPDSFYDDGAGAVLEDALAQAHAAAD
AGAEWVDVGGVPFAPGAELDPAEEAARVVPLIAALRSGDGAGSSEASRRLILSADTFQPA
VAEAALAAGADVVNDTTGLFHADLGRVVAAAGAHLVVTHSLAHVRGPRAVVPRPTYGDVV
TEVRDHLRRTVDRAVALGVPEERIIVDPGHDLNKNTRHTLEITRRLDEIAALGLPVLAAV
SNKDFIGESLDKHRHERLPGSLAAAAACVYGGARILRMHDADASVSAARMLECVFGWREP
ARLVHNMGAENPPPDRSTLAEHRVHGGWA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccccctccgtccccctcgtccacccggtgcaccggttcgcccaccaggagatc
gacttccgccgccggatcgtcacgatggccgtggtcaaccgcaccccggactccttctac
gacgacggcgccggcgccgtcctggaggacgccctcgcccaggcccacgccgcggcggac
gccggagccgagtgggtcgacgtcggcggcgtgccgttcgcgcccggggcggagctcgac
cccgccgaggaggcggcgcgggtggtccccctgatcgcggccctgcggagcggggacgga
gccgggtcgtccgaggcgtcgcgccggctgatcctctcggcggacacgttccagccggcc
gtggccgaggcggccctggccgcgggggcggacgtcgtcaacgacaccacgggactgttc
cacgcggacctgggccgggtggtggccgccgcgggcgcgcacctcgtggtcacccactcc
ctcgcccacgtgcgcggaccccgggccgtggtcccccggccgacgtacggcgacgtcgtc
acggaggtccgcgaccacctgcggcgcaccgtcgaccgtgctgtggcgctcggcgtcccc
gaggagaggatcatcgtggaccccggccacgatctgaacaagaacacccggcacaccctc
gagatcacgcggcggctggacgagatcgccgccctggggctgcccgtgctggccgcggtc
tcgaacaaggacttcatcggcgagagcctggacaagcaccggcacgagcggctgcccggc
tcgctggccgcggccgcggcctgcgtgtacggcggcgcccggatcctgcgcatgcacgac
gccgacgcctccgtctcggcggcccgcatgctcgagtgcgtgttcgggtggcgtgagccg
gcgcgcctggtccacaacatgggtgcggagaacccgccgccggaccgcagcaccctcgcc
gaacaccgggtccatgggggctgggcgtga

DBGET integrated database retrieval system