KEGG   Micrococcus luteus: Mlut_15180Help
Entry
Mlut_15180        CDS       T00918                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mlu  Micrococcus luteus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mlut_15180
Enzymes [BR:mlu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mlut_15180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1665805..1666641)
Genome map
AA seq 278 aa AA seqDB search
MRVLLTRQPAQAGDLEAGLAGAEVAGRRLRVGFLPLTDFALPDDDGPLRALLADWAGADG
DAAGPVRSDGSRWLVLTSANTVRALRAVGWDGHVPAGARIAATGPGTARVLTEAGCDAAP
WLPPEDRSAEGLIAGLAALHPRGARAWLPQSDRARPRLAHGLRAAGWDVRTGLAYRTVPY
PAQAGRRLLDGADEGRGDVVTPARLSAVAAGTAVVLTSSSAVEEFVAAGLAPLAGERVRL
VAIGAPTRDTCARRGLPLLGTAPTPDAAGVLAVLRAAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctgctcacccgccagccggcccaggccggcgacctcgaggccggtctcgcc
ggcgccgaggtggcggggcggcggctgcgggtcggcttcctgccgctgaccgacttcgcg
ctgcccgacgacgacggcccgctgcgcgcgctgctcgcggactgggcgggggccgacggt
gatgcggccgggccggtgcgctcggacgggtctcgctggctcgtgctgacgagcgccaac
accgtacgggccctcagggccgtcggctgggacggtcatgtcccggcgggcgcgcggatc
gcggccaccgggccaggaacggcacgggtgctgaccgaggcgggctgcgacgcggcgccg
tggctgccgccggaggaccgctccgccgagggcctgatcgccggactcgccgccctgcat
ccccgcggcgcccgtgcgtggctgccccagtccgaccgggcccggccccgcctcgcccac
ggcctgcgcgcggcgggctgggacgtgcggaccggactcgcctaccggacggtgccgtat
ccggcgcaggccggcaggcggctgctcgacggggcggacgaaggccggggggacgtcgtg
acgcccgcgcggctgtccgcggtcgcggcggggaccgccgtggtgctcaccagctcgtcc
gcggtggaggagttcgtggccgcgggtctggcaccgttggcgggggagcgggtgcggctc
gtggcgatcggcgcgccgacccgtgacacgtgcgcgcggcggggtctgcccctgctcggg
acggcccccacgccggacgcggccggagtgctggccgtgctgcgcgctgcggcctga

DBGET integrated database retrieval system