KEGG   Micrococcus luteus: Mlut_15220Help
Entry
Mlut_15220        CDS       T00918                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mlu  Micrococcus luteus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mlut_15220
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Mlut_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669897..1671405)
Genome map
AA seq 502 aa AA seqDB search
MSGTALVVGGGIAGLVAAHRLSTAGWDVTLAEATSVLGGAVSPRFLDVPSHGETGAPETQ
TLELDGGAESFAVRGAAVRALLEELGLAEKIVAPEPLGSWLHGPAGPVRAPRLGIAGIPG
DLDAEDLAAALTPAGLERARQDAEAPMDRWAAALAAGEPVTVAQVVADRLGDEVLDRLVA
PVVAGVHSADPAVVELERVAPGLLAAAVEHGGLAAGVAALRSTGTPGSLVAGLDGGMVRL
TGRLVDALREDGATVLRGVRVAALSRVPATGGWWAQISDRDDEVVRGLDVDRVVLAVDGV
TAWDLLAPLSADALDPDAGPALGEGIALATLVVEAAGLDDAPRGTGVLVGAGTDVAAKAL
THATAKWAWLREVVARPQEDGVARHPHRHVLRLSYGRQGGGPEALGHRSADEELLAQALV
DTATLTGVPLAEEDVVARTVTRWRRSIPPQAGPDRAKADTLIDWARDVPGLDLVGSWVHG
TGLAAVVAGVDRTLGADAPPAG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacggcgctcgtggtcggcggcggcatcgccggcctcgtcgcggcccaccgg
ctgtccacggcgggctgggacgtgaccctcgccgaggccacctccgtgctcgggggcgcg
gtctccccgcgcttcctcgacgtcccctcgcacggcgagaccggagcccccgagacccag
accctcgaactcgacggcggcgccgagtcgttcgccgtccgcggcgccgccgtgcgcgcg
ctcctggaggagctcgggctggccgagaagatagtcgcgcccgagcccctcggctcgtgg
ctgcacggtcccgccggccccgtgcgtgcgccgcgcctcggcatcgccggcatccccggc
gacctcgacgccgaggacctcgccgccgccctcacgccggccggcctggagcgcgcccgg
caggatgccgaggcccccatggatcgctgggccgccgcgctcgcggccggcgaaccggtg
accgtcgcgcaggtcgtggccgaccgcctcggcgacgaggtgctcgaccgcctcgtggcc
cccgtcgtcgccggagtccactcggccgaccccgcggtcgtcgagctggagcgcgtggcc
cccggcctgctcgccgccgccgtggagcacggcgggctggccgcgggcgtcgccgcgctg
cggtccaccgggacccccggctcgctcgtggccgggctggacggcggcatggtccgcctc
accggccggctcgtcgacgcgctgcgcgaggacggggccaccgtcctgcgcggcgtgcgg
gtggccgccctgtcccgcgtgcccgccaccggcggctggtgggcccagatctcggaccgg
gacgacgaggtcgtccgcgggctcgacgtggaccgcgtcgtgctggccgtggacggcgtc
accgcctgggacctgctggccccgctctcggccgacgccctggaccccgacgccggcccc
gccctcggcgaggggatcgcgctggccacgctcgtcgtcgaggccgcgggcctggacgac
gcgccacgcggcaccggagtgctggtcggcgccgggacggacgtggccgccaaggccctg
acccacgccaccgccaagtgggcgtggctgcgcgaggtcgtcgcgcggccgcaggaggac
ggcgtcgcccgccacccccaccgccacgtgctgcgcctgtcctacggccgccagggcggc
gggcccgaggccctgggccaccgcagcgcggacgaggagttgctggcgcaggcgctcgtg
gacacggcgaccctcaccggggtgccactggcggaggaggacgtcgtcgcccgcaccgtc
acccgctggcgccgctccatcccgccgcaggccggccccgaccgcgcgaaggcggacacg
ctgatcgactgggcacgggacgtgcccggcctcgacctcgtgggcagctgggtgcacggc
accgggctggccgccgtcgtcgccggcgtggaccgcaccctcggcgccgacgcgccgccc
gccggctga

DBGET integrated database retrieval system