KEGG   Micrococcus luteus: Mlut_17370Help
Entry
Mlut_17370        CDS       T00918                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_17370
   01230 Biosynthesis of amino acids
    Mlut_17370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_17370
   00030 Pentose phosphate pathway
    Mlut_17370
   00051 Fructose and mannose metabolism
    Mlut_17370
   00052 Galactose metabolism
    Mlut_17370
  Energy metabolism
   00680 Methane metabolism
    Mlut_17370
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mlut_17370
Protein phosphatases and associated proteins [BR:mlu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mlut_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880806..1881825
Genome map
AA seq 339 aa AA seqDB search
MLTSGGDCPGLNAVIRSAVLHGIKSYDMEMVGIRNGWSGLIEKDVEDLPRSRVRGLARTG
GTILGTSRTHPYDAEGGGPENMLRNLRELDIDAVIAIGGEGTLAGANRLAADGLPIVGVP
KTIDNDLQGTDYTFGFDTAVQIATDAMDRLRTTGESHHRCMVAEVMGRHVGWIALHSGMA
AGAHAILIPEVRTPMSQVAEWVQQVHDRGRSPLVVVAEGFIPEGHDDPLAEAGVEASGRP
RLGGIGEWVTREIEEMTGIETRSTILGHIQRGGAPTATDRVLSTRFGMGAVDLVAQRRWG
QMVAANGTEIISIPMSAALKGLKKVPVSRYDEAKILFGR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctcacctccggaggcgactgccccggcctcaacgccgtcatccgctccgccgtcctg
cacggcattaagtcgtacgacatggagatggtgggcatccgcaacgggtggtccggcctg
atcgagaaggacgtcgaggacctgccccgctcccgcgtgcgcggcctggcccgcaccggc
ggcaccatcctcggcacctcgcgcacgcacccctacgacgccgagggcggcggcccggag
aacatgctccgcaacctgcgcgagctggacatcgacgccgtcatcgccatcggcggcgag
ggcaccctggccggcgcgaaccgcctggccgcggacgggctgccgatcgtgggcgtgccc
aagacgatcgacaacgacctgcagggcaccgactacacgttcggcttcgacacggccgtg
cagatcgccacggacgccatggaccgactgcgcaccacgggcgagtcccaccaccgctgt
atggtcgccgaggtcatgggccgccacgtcggctggatcgccctgcactcgggcatggcc
gccggcgcccacgcgatcctcatccccgaggtccgcaccccgatgtcccaggtcgccgag
tgggtgcagcaggtccacgaccgcggccgctccccgctggtcgtggtggcggagggcttc
atccccgagggccacgacgacccgctggccgaggccggggtcgaggcgtccggccggccg
cgtctgggcggcatcggcgagtgggtgacccgcgagatcgaggagatgacgggcatcgag
acgcgcagcaccatcctgggccacatccagcgcggcggcgcccccaccgccacggaccgc
gtgctctccacgcgcttcggcatgggcgccgtcgatctcgtcgcgcagcgccgctgggga
cagatggtggcggccaacggcacggagatcatctccatccccatgagcgccgccctcaag
ggcctcaagaaggtgccggtctcgcgctacgacgaggcgaagatcctgttcggccggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system