KEGG   Micrococcus luteus: Mlut_17470Help
Entry
Mlut_17470        CDS       T00918                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mlu  Micrococcus luteus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlut_17470
   00670 One carbon pool by folate
    Mlut_17470
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mlut_17470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889065..1889625
Genome map
AA seq 186 aa AA seqDB search
MSRATRPTEPVIAMIWAQTPGRVIGRDGTMPWHVPEDLAHFRAHTHGHPVIMGRRTWESF
PARFRPLPGRTNIVVSRTLTATEQAGAQLRAAGAVVVPDFGAALAAAAEADGCDTVWVIG
GATLYDQALDVASRAEVTVIDADVDGDTHAPPLDARWRRTAVDPAPDAWLDSASGPRHRF
ERWERD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggccacccgtcccaccgagcccgtaatcgccatgatctgggcccagaccccc
gggcgcgtcatcggccgcgacggcaccatgccgtggcacgtcccggaggacctcgcccac
ttccgggcccacacgcacggccaccccgtgatcatgggccggcgcacgtgggagtcgttc
ccggcgcggttccgcccgctgcccgggcgcacgaacatcgtggtctcccgcaccctgacg
gccaccgagcaggccggcgcccagctgcgggccgcgggcgccgtcgtcgtgccggacttc
ggggcggccctggccgccgcggccgaggccgacggctgtgacaccgtgtgggtgatcggc
ggggcgaccctctacgaccaggccctcgacgtggcctcgcgcgccgaggtgaccgtgatc
gacgccgacgtcgacggcgacacgcacgccccgccgctcgacgcccgctggcggcgcacc
gccgtcgaccccgcccccgacgcgtggctggactccgcctccggcccgcgccaccgcttc
gaacgatgggaacgcgactga

DBGET integrated database retrieval system