KEGG   Micrococcus luteus: Mlut_17470Help
Entry
Mlut_17470        CDS       T00918                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mlu  Micrococcus luteus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mlu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mlu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889065..1889625
Genome map
AA seq 186 aa AA seqDB search
MSRATRPTEPVIAMIWAQTPGRVIGRDGTMPWHVPEDLAHFRAHTHGHPVIMGRRTWESF
PARFRPLPGRTNIVVSRTLTATEQAGAQLRAAGAVVVPDFGAALAAAAEADGCDTVWVIG
GATLYDQALDVASRAEVTVIDADVDGDTHAPPLDARWRRTAVDPAPDAWLDSASGPRHRF
ERWERD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggccacccgtcccaccgagcccgtaatcgccatgatctgggcccagaccccc
gggcgcgtcatcggccgcgacggcaccatgccgtggcacgtcccggaggacctcgcccac
ttccgggcccacacgcacggccaccccgtgatcatgggccggcgcacgtgggagtcgttc
ccggcgcggttccgcccgctgcccgggcgcacgaacatcgtggtctcccgcaccctgacg
gccaccgagcaggccggcgcccagctgcgggccgcgggcgccgtcgtcgtgccggacttc
ggggcggccctggccgccgcggccgaggccgacggctgtgacaccgtgtgggtgatcggc
ggggcgaccctctacgaccaggccctcgacgtggcctcgcgcgccgaggtgaccgtgatc
gacgccgacgtcgacggcgacacgcacgccccgccgctcgacgcccgctggcggcgcacc
gccgtcgaccccgcccccgacgcgtggctggactccgcctccggcccgcgccaccgcttc
gaacgatgggaacgcgactga

DBGET integrated database retrieval system