KEGG   Micrococcus luteus: Mlut_18230Help
Entry
Mlut_18230        CDS       T00918                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mlu  Micrococcus luteus
Pathway
mlu00010  Glycolysis / Gluconeogenesis
mlu00620  Pyruvate metabolism
mlu00640  Propanoate metabolism
mlu00680  Methane metabolism
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01120  Microbial metabolism in diverse environments
mlu01130  Biosynthesis of antibiotics
mlu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_18230
   00620 Pyruvate metabolism
    Mlut_18230
   00640 Propanoate metabolism
    Mlut_18230
  Energy metabolism
   00680 Methane metabolism
    Mlut_18230
Enzymes [BR:mlu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mlut_18230
Lipid biosynthesis proteins [BR:mlu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mlut_18230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACS31306
UniProt: C5CCV4
Position
1971384..1973324
Genome map
AA seq 646 aa AA seqDB search
MDEQIPTFPPPAEFAAQAVAGADLYEEAAEDRLAYWARRAREILHWEQDFTDVLDWSDAP
FAKWFVGGTTNAAYNALDRHVEAGHGDRVAIHFEGEPGDTRTYTYADLAAEVRRAANAFE
SLGVAKGDRVAVYLPMIPEAVITMLACARIGAVHSVVFGGFSSDALRSRVDDAEAKLVVT
ADGSFRRGKPSMLKPAVDQALSAPGHTAEHVLVVRRNEAEVEMTEGRDLWWHDVVDGQSD
EHELVWHDAEHPLYILYTSGTTGKPKGILHTTGGYLVQAAATHHDTFDLHPESDVFWCTA
DVGWVTGHSYVAYAPLVNGATQVIYEGTPDSPHQGRWWEIVQKYGVSILYTAPTAIRTFM
KWGRHIPDEYDLSSLRVLGSVGEAINPEAWRWYHEVIGAGRCPIVDTWWQTETGAHMLTP
LPGVTTLKPGSAQRPVPGVVLEVVDELGEPMTDTSAGFLVVREPWPAMLRGIWGDRERFK
ETYWSRFPGMYFAGDGARYDEDGDIWLLGRVDDVMNVSGHRLSTTEIESSLVAHPSVAES
AVVGAKDETTGEAVVAFVLLTAVAVAADRDVAEVEEELRQHVGKDIGPIAKPKRVLVVPE
LPKTRSGKIMRRLLKDVAEGRDPGDSTTLADPTVMQRIVETLAPKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagatccccacgttcccgcccccggccgagttcgccgcccaggcggtggcc
ggagccgacctgtacgaggaggccgccgaggaccgcctggcctactgggcccgccgcgcc
cgcgagatcctgcactgggagcaggacttcaccgacgtcctggactggtccgacgcgccc
ttcgcgaagtggttcgtcggcggcaccaccaacgccgcgtacaacgccctggaccgccac
gtcgaggccggccacggcgaccgcgtggccatccacttcgagggcgagcccggcgacacc
cggacctacacctacgccgacctggccgccgaggtccggcgcgccgccaacgcgttcgag
tccctcggcgtggccaagggcgaccgcgtggccgtctacctgccgatgatccccgaggcc
gtcatcacgatgctcgcgtgcgcgcgcatcggcgcggtccactccgtggtgttcggcggc
ttctcctccgacgccctgcgctcccgcgtggacgacgccgaggccaagctcgtcgtcacg
gcggacggctccttccgccgcggcaagccctccatgctcaagcccgccgtggaccaggcc
ctctccgcgccgggccacaccgccgagcacgtgctcgtggtccgccgcaacgaggccgag
gtcgagatgaccgagggccgcgacctgtggtggcacgacgtcgtggacggccagtccgac
gaacacgagctcgtgtggcacgacgccgagcacccgctctacatcctgtacacctccggc
accaccgggaagccgaagggcatcctgcacaccaccggcggctacctcgtgcaggccgcg
gccacccaccacgacaccttcgacctgcacccggagtcggacgtcttctggtgcaccgcc
gacgtcggctgggtcaccgggcactcctacgtcgcctacgcgccgctggtcaacggcgcc
acccaggtgatctacgagggcaccccggactccccgcaccagggccgctggtgggagatc
gtgcagaagtacggcgtgagcatcctctacacggcgccgacggcgatccgcacgttcatg
aagtggggccggcacatcccggacgagtacgacctctccagcctgcgcgtgctcggctcc
gtgggcgaggccatcaacccggaggcctggcgctggtaccacgaggtcatcggcgccggc
cgctgccccatcgtggacacctggtggcagaccgagacgggcgcccacatgctcaccccg
ctgcccggcgtgaccaccctcaagcccggttccgcccagaggccggtgcccggcgtcgtg
ctggaggtcgtggacgagctcggcgagcccatgacggacacgagcgcgggcttcctcgtg
gtgcgcgagccgtggccggccatgctgcgcggcatctggggcgaccgggagcgcttcaag
gagacctactggtcccgcttccccggcatgtacttcgccggcgacggcgcccgctacgac
gaggacggcgacatctggctgctgggccgcgtggacgacgtcatgaacgtctccggccac
cgcctgtccaccaccgagatcgagtcctccctcgtggcgcacccgtccgtggccgagtcc
gcggtggtcggtgcgaaggacgagaccacgggtgaggcggtcgtcgcgttcgtcctgctc
accgcggtcgccgtcgcggccgaccgcgacgtcgccgaggtcgaggaggagctgcggcag
cacgtgggcaaggacatcggccccatcgccaagcccaagcgcgtgctcgtggtccccgag
ctgcccaagacgcgctccggcaagatcatgcgccgtctgctcaaggacgtggccgagggc
cgcgacccgggcgactccaccacgctggccgaccccacggtcatgcagcgcatcgtggag
acgctcgccccgaaggcctga

DBGET integrated database retrieval system