KEGG   Micrococcus luteus: Mlut_18230Help
Entry
Mlut_18230        CDS       T00918                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_18230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_18230
   00620 Pyruvate metabolism
    Mlut_18230
   00640 Propanoate metabolism
    Mlut_18230
  Energy metabolism
   00680 Methane metabolism
    Mlut_18230
Enzymes [BR:mlu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mlut_18230
Lipid biosynthesis proteins [BR:mlu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mlut_18230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1971384..1973324
Genome map
AA seq 646 aa AA seqDB search
MDEQIPTFPPPAEFAAQAVAGADLYEEAAEDRLAYWARRAREILHWEQDFTDVLDWSDAP
FAKWFVGGTTNAAYNALDRHVEAGHGDRVAIHFEGEPGDTRTYTYADLAAEVRRAANAFE
SLGVAKGDRVAVYLPMIPEAVITMLACARIGAVHSVVFGGFSSDALRSRVDDAEAKLVVT
ADGSFRRGKPSMLKPAVDQALSAPGHTAEHVLVVRRNEAEVEMTEGRDLWWHDVVDGQSD
EHELVWHDAEHPLYILYTSGTTGKPKGILHTTGGYLVQAAATHHDTFDLHPESDVFWCTA
DVGWVTGHSYVAYAPLVNGATQVIYEGTPDSPHQGRWWEIVQKYGVSILYTAPTAIRTFM
KWGRHIPDEYDLSSLRVLGSVGEAINPEAWRWYHEVIGAGRCPIVDTWWQTETGAHMLTP
LPGVTTLKPGSAQRPVPGVVLEVVDELGEPMTDTSAGFLVVREPWPAMLRGIWGDRERFK
ETYWSRFPGMYFAGDGARYDEDGDIWLLGRVDDVMNVSGHRLSTTEIESSLVAHPSVAES
AVVGAKDETTGEAVVAFVLLTAVAVAADRDVAEVEEELRQHVGKDIGPIAKPKRVLVVPE
LPKTRSGKIMRRLLKDVAEGRDPGDSTTLADPTVMQRIVETLAPKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagatccccacgttcccgcccccggccgagttcgccgcccaggcggtggcc
ggagccgacctgtacgaggaggccgccgaggaccgcctggcctactgggcccgccgcgcc
cgcgagatcctgcactgggagcaggacttcaccgacgtcctggactggtccgacgcgccc
ttcgcgaagtggttcgtcggcggcaccaccaacgccgcgtacaacgccctggaccgccac
gtcgaggccggccacggcgaccgcgtggccatccacttcgagggcgagcccggcgacacc
cggacctacacctacgccgacctggccgccgaggtccggcgcgccgccaacgcgttcgag
tccctcggcgtggccaagggcgaccgcgtggccgtctacctgccgatgatccccgaggcc
gtcatcacgatgctcgcgtgcgcgcgcatcggcgcggtccactccgtggtgttcggcggc
ttctcctccgacgccctgcgctcccgcgtggacgacgccgaggccaagctcgtcgtcacg
gcggacggctccttccgccgcggcaagccctccatgctcaagcccgccgtggaccaggcc
ctctccgcgccgggccacaccgccgagcacgtgctcgtggtccgccgcaacgaggccgag
gtcgagatgaccgagggccgcgacctgtggtggcacgacgtcgtggacggccagtccgac
gaacacgagctcgtgtggcacgacgccgagcacccgctctacatcctgtacacctccggc
accaccgggaagccgaagggcatcctgcacaccaccggcggctacctcgtgcaggccgcg
gccacccaccacgacaccttcgacctgcacccggagtcggacgtcttctggtgcaccgcc
gacgtcggctgggtcaccgggcactcctacgtcgcctacgcgccgctggtcaacggcgcc
acccaggtgatctacgagggcaccccggactccccgcaccagggccgctggtgggagatc
gtgcagaagtacggcgtgagcatcctctacacggcgccgacggcgatccgcacgttcatg
aagtggggccggcacatcccggacgagtacgacctctccagcctgcgcgtgctcggctcc
gtgggcgaggccatcaacccggaggcctggcgctggtaccacgaggtcatcggcgccggc
cgctgccccatcgtggacacctggtggcagaccgagacgggcgcccacatgctcaccccg
ctgcccggcgtgaccaccctcaagcccggttccgcccagaggccggtgcccggcgtcgtg
ctggaggtcgtggacgagctcggcgagcccatgacggacacgagcgcgggcttcctcgtg
gtgcgcgagccgtggccggccatgctgcgcggcatctggggcgaccgggagcgcttcaag
gagacctactggtcccgcttccccggcatgtacttcgccggcgacggcgcccgctacgac
gaggacggcgacatctggctgctgggccgcgtggacgacgtcatgaacgtctccggccac
cgcctgtccaccaccgagatcgagtcctccctcgtggcgcacccgtccgtggccgagtcc
gcggtggtcggtgcgaaggacgagaccacgggtgaggcggtcgtcgcgttcgtcctgctc
accgcggtcgccgtcgcggccgaccgcgacgtcgccgaggtcgaggaggagctgcggcag
cacgtgggcaaggacatcggccccatcgccaagcccaagcgcgtgctcgtggtccccgag
ctgcccaagacgcgctccggcaagatcatgcgccgtctgctcaaggacgtggccgagggc
cgcgacccgggcgactccaccacgctggccgaccccacggtcatgcagcgcatcgtggag
acgctcgccccgaaggcctga

DBGET integrated database retrieval system