KEGG   Micrococcus luteus: Mlut_18390Help
Entry
Mlut_18390        CDS       T00918                                 

Definition
copper/silver-translocating P-type ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
mlu  Micrococcus luteus
Brite
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     Mlut_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1986518..1988755
Genome map
AA seq 745 aa AA seqDB search
MSTPHHHDHPTDQTAEHPDPNPHAGHANHTDHAAHHPADAATHGQAMPQGHAHSALDEDH
QVHDHGQHAGHSTAMFKNRFWVSLVLSIPVVFFSHMVGQLLGYHVPEFPGSAWIAPVLGT
VIYLYGGMPFLKGGLTELRARQPGMMLLIAMAITVAFVASWVTTLGIGDLMLDFWWELAL
LVVIMLLGHWMEMRALGAASSALDALAALLPEEAEKVVDGDTITVPITELAVGDVVLVRA
GARVPADGTILEGAAEFDEAMITGESKPVLRQAGDTVVAGTVATDNTVRVKVAAVGTDTT
LAGIQRMVADAQESSSRAQALADRAAALLFWFALVAAIITAIVWTAIGQPTDAVTRTVTV
LVIACPHALGLAIPLVIALSTEKAAKSGVLIKDRMALERMRTIDVVLFDKTGTLTEGAHA
VTGVAAAPGISEAELLAYAAAAEADSEHPVARAIVTAAGQHPQASTLRKRGTDFSAAMGR
GVRATVDGSEILVGGPNMLRELNLTMPAEITEHTASWTARGAGVLHVVRDGSVIGAVAVE
DKIRPESRAAVAALHARGIKVAMITGDARQVAEAVGADLGIDEVFAEVLPQDKDTKVTEL
QSRGLSVAMVGDGVNDAPALARAEVGIAIGAGTDVAMESAGVVLASNDPRAVLSMIELSQ
ASYTKMIQNLVWATGYNVLAVPLAAGVLAPIGFVLSPAVGAILMSASTIVVALNAQLLRR
INLDPGHLAPLGAPRPEAALQPATS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgcaccaccacgatcaccccaccgaccagaccgccgaacacccagacccg
aacccccacgccggccacgccaaccacaccgaccatgccgcccaccaccccgcggacgcg
gccacccacgggcaggccatgccccagggccacgcccactcggccctggacgaggaccac
caggtccacgaccacggtcagcacgccgggcattccaccgcgatgttcaagaaccggttc
tgggtctcactggtgctctccatcccggtggtgttcttcagccacatggtcgggcagctg
ctgggctaccacgtccccgagttcccgggctcggcgtggatcgccccggtgctgggcacc
gtgatctacctctatggcggcatgcccttcctgaagggcgggctgaccgagttgcgcgcc
cgccagccggggatgatgctgctgatcgcgatggccatcacggtggccttcgtcgcctcc
tgggtcacgaccctgggcatcggggacctgatgctggacttctggtgggagctggcgctg
ctggtggtcatcatgctgctgggccactggatggagatgcgcgccctgggcgcggcctcc
tccgccttggacgcgctggcggcgctgctgccggaggaggccgagaaggtcgtggacggt
gacaccatcaccgtgccgatcaccgagttggccgtgggcgatgtggtgctagtgcgggcc
ggggcccgggtgccggccgacgggaccatcctcgagggcgccgcggagttcgacgaggcg
atgatcaccggggagtcgaagcctgtgctgcgccaggccggggacacggtggtcgctggg
accgtggccaccgacaacaccgtgcgggtgaaggtggccgccgtcgggaccgacacgacc
ctggccgggatccagcggatggtcgccgacgcccaggagtcctcctcccgggcccaggcg
ttggcggaccgggccgcggccctgctgttctggttcgccctggttgcggcgatcatcacc
gcgatcgtgtggaccgcgatcggccagcccaccgacgcggtcacccgcaccgtgaccgtg
ctggtcatcgcctgcccgcacgccctgggcctggccatcccgctggtgatcgccctctcc
acggagaaggccgccaagtccggggtcctgatcaaggaccggatggccctggagcggatg
cggaccatcgacgtggtcctgttcgacaagaccggcaccctgaccgagggcgcccacgcc
gtcaccggtgtcgccgcggcgcccggcatttccgaggccgagctgttggcctacgccgcc
gcggccgaggctgacagcgagcacccggtggcccgggccatcgtcaccgccgccgggcag
cacccgcaggccagcacgttgcgcaagcgcggcacggacttcagtgctgccatgggccgc
ggggtgcgcgccaccgtggacggctccgagatccttgtcggcgggccgaacatgctgcgc
gagcttaacctgaccatgccggcggagatcactgagcacaccgcctcctggaccgcgcgc
ggggccggggtgttgcatgtggtccgcgacgggtccgttatcggcgcggtcgccgtggag
gacaagatccgccccgagtcccgggccgccgtggccgccctgcacgcccgcggcatcaag
gtcgcgatgatcaccggcgatgcccgccaggtcgccgaggccgtcggggcggacctgggc
atcgacgaggtcttcgccgaggtcctcccccaggacaaggacaccaaggtcaccgagttg
cagtcccggggactgtccgtggccatggtgggcgacggcgtcaacgacgccccggcgctg
gcgcgggccgaggtcggcatcgccatcggcgccggcaccgacgtggccatggagtccgcc
ggcgttgtgctggccagcaacgacccccgcgcggtgctgtcgatgatcgagctctcccag
gccagctacaccaagatgatccagaacctggtgtgggccaccggctacaacgtgctcgcc
gtgccgctggccgccggcgtgctcgccccgatcgggttcgtgctctcccccgcggtgggc
gcgatcctgatgtccgcctccaccatcgtggtcgccctcaacgcccaactgctgcgccgg
atcaacctggacccgggccacctggcccccctcggcgccccccggccggaggctgccctt
caacccgcgacctcctga

DBGET integrated database retrieval system