KEGG   Micrococcus luteus: Mlut_19690Help
Entry
Mlut_19690        CDS       T00918                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mlu  Micrococcus luteus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mlu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mlu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mlu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126288..2127946
Genome map
AA seq 552 aa AA seqDB search
MSHLTAHPAVTARSRPRLRPCHPARVTSHTDPAHPAAHPVSRRTLLGGAGFVVASAALLS
TPAGTAHAATGPTPFTLGVASGDPWPDGAVLWTRLAVDPLALDGLGGMPDQSFRVEYRVA
TDEGFHKVVRSGAVTTDRTQGYAVHVTLTGLRPGTEYFYRFRALGHLSRVGRTVTAPARG
SNPSRLTMTVASCANWEHGYFTAYGHMAAERPDLMVHLGDYYYEIMPYGYPVSSGVPRAH
RNGESRTLAQYRARMAQYKTDPHLQDAHAAAPWLVIFDDHELENNWADETPEIWDPNFLA
RRAAAFQAYYENMPLRASSVPRGIDMQLYRRVQWGDLATFHLLDTRQYRSDQANLDLVKV
VDADARDPRRTITGAAQEAWLREGFETSVARWDLITQQVPFVQYDRSSGPLLWGDMDSWD
GYVASRDRVVSAWTAAGVRNPVVLTGDIHEAFASDIKRDFNDLSSESVGVELITTSITSG
GDGSDAAAEALAWNPHIKFNNDLRGYLRVDLSAHMLEARFRVVDYVSELGSSVRTRAVFG
VGDGEHRLHRIA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacctgaccgcccaccccgccgtcaccgcccggtcacgtccgcgtctccgcccc
tgccaccctgcacgggtgacctcgcacactgaccccgcgcacccggccgcccaccccgtc
tcccgccgcaccctcctcggcggggcgggcttcgtcgtcgcctccgcggcgctgctgtcc
acgccagccggcaccgcccacgcggccaccggccccacgccgttcacgctcggcgtcgcc
tcgggcgacccgtggcccgacggcgcggtcctgtggacccgcctggccgtggaccccctc
gcgctcgacggcctcggcggcatgccggaccagtcgttcagggtggagtaccgggtggcc
acggacgagggcttccacaaggtcgtccggtcgggcgccgtcaccacggaccgcacgcag
ggctacgcggtgcacgtcacgctcaccggtctgcgccccggcaccgagtacttctaccgg
ttccgcgcgctcggccacctctcgcgcgtcggccgcacggtcaccgcgcccgcccgcggc
tcgaacccgagccgcctcaccatgacggtcgcctcgtgcgccaactgggagcacggctac
ttcaccgcctacggccacatggccgccgagcgtcccgacctcatggtccacctgggcgac
tactactacgagatcatgccgtacgggtacccggtctcctcgggcgtcccacgcgcccac
aggaacggggagtcccgcaccctcgcccagtaccgggcccgcatggcgcagtacaagacg
gacccgcacctgcaggacgcgcacgccgccgccccgtggctcgtgatcttcgacgaccac
gagctcgagaacaactgggcggacgagaccccggagatctgggacccgaacttcctcgcg
cgccgcgccgccgcgttccaggcgtactacgagaacatgccgctccgcgcgtcgtccgtg
ccccgcggcatcgacatgcagctctaccgccgcgtccagtggggcgacctcgccacgttc
cacctcctggacacgcgccaataccgctcggaccaggccaacctggacctggtgaaggtc
gtcgacgccgacgcacgggacccgcggcgcaccatcacgggcgcggcgcaggaggcgtgg
ctgcgcgagggcttcgagacctcggtcgcccgctgggacctcatcacgcagcaggtgccg
ttcgtgcagtacgaccgctcctccggcccgctcctgtggggcgacatggactcatgggac
ggctacgtcgcctcgcgcgaccgcgtggtcagcgcgtggaccgcggcgggcgtccgcaac
cccgtggtgctcaccggtgacatccacgaggccttcgcctcggacatcaagcgggacttc
aacgacctctcctcggagtccgtgggcgtcgagctcatcaccacgtcgatcacctcgggc
ggcgacggctcggacgccgccgcggaggcgctcgcgtggaacccgcacatcaagttcaac
aacgacctgcgcggctacctccgcgtggacctctccgcccacatgctcgaggcccgcttc
cgcgtggtcgactacgtgagcgagctgggctcgtcggtgcgcacgcgcgcggtcttcggc
gtcggcgacggcgagcatcggctccaccggatcgcctga

DBGET integrated database retrieval system