KEGG   Micrococcus luteus: Mlut_19690Help
Entry
Mlut_19690        CDS       T00918                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mlu  Micrococcus luteus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlut_19690
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mlut_19690
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mlut_19690
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mlut_19690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126288..2127946
Genome map
AA seq 552 aa AA seqDB search
MSHLTAHPAVTARSRPRLRPCHPARVTSHTDPAHPAAHPVSRRTLLGGAGFVVASAALLS
TPAGTAHAATGPTPFTLGVASGDPWPDGAVLWTRLAVDPLALDGLGGMPDQSFRVEYRVA
TDEGFHKVVRSGAVTTDRTQGYAVHVTLTGLRPGTEYFYRFRALGHLSRVGRTVTAPARG
SNPSRLTMTVASCANWEHGYFTAYGHMAAERPDLMVHLGDYYYEIMPYGYPVSSGVPRAH
RNGESRTLAQYRARMAQYKTDPHLQDAHAAAPWLVIFDDHELENNWADETPEIWDPNFLA
RRAAAFQAYYENMPLRASSVPRGIDMQLYRRVQWGDLATFHLLDTRQYRSDQANLDLVKV
VDADARDPRRTITGAAQEAWLREGFETSVARWDLITQQVPFVQYDRSSGPLLWGDMDSWD
GYVASRDRVVSAWTAAGVRNPVVLTGDIHEAFASDIKRDFNDLSSESVGVELITTSITSG
GDGSDAAAEALAWNPHIKFNNDLRGYLRVDLSAHMLEARFRVVDYVSELGSSVRTRAVFG
VGDGEHRLHRIA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacctgaccgcccaccccgccgtcaccgcccggtcacgtccgcgtctccgcccc
tgccaccctgcacgggtgacctcgcacactgaccccgcgcacccggccgcccaccccgtc
tcccgccgcaccctcctcggcggggcgggcttcgtcgtcgcctccgcggcgctgctgtcc
acgccagccggcaccgcccacgcggccaccggccccacgccgttcacgctcggcgtcgcc
tcgggcgacccgtggcccgacggcgcggtcctgtggacccgcctggccgtggaccccctc
gcgctcgacggcctcggcggcatgccggaccagtcgttcagggtggagtaccgggtggcc
acggacgagggcttccacaaggtcgtccggtcgggcgccgtcaccacggaccgcacgcag
ggctacgcggtgcacgtcacgctcaccggtctgcgccccggcaccgagtacttctaccgg
ttccgcgcgctcggccacctctcgcgcgtcggccgcacggtcaccgcgcccgcccgcggc
tcgaacccgagccgcctcaccatgacggtcgcctcgtgcgccaactgggagcacggctac
ttcaccgcctacggccacatggccgccgagcgtcccgacctcatggtccacctgggcgac
tactactacgagatcatgccgtacgggtacccggtctcctcgggcgtcccacgcgcccac
aggaacggggagtcccgcaccctcgcccagtaccgggcccgcatggcgcagtacaagacg
gacccgcacctgcaggacgcgcacgccgccgccccgtggctcgtgatcttcgacgaccac
gagctcgagaacaactgggcggacgagaccccggagatctgggacccgaacttcctcgcg
cgccgcgccgccgcgttccaggcgtactacgagaacatgccgctccgcgcgtcgtccgtg
ccccgcggcatcgacatgcagctctaccgccgcgtccagtggggcgacctcgccacgttc
cacctcctggacacgcgccaataccgctcggaccaggccaacctggacctggtgaaggtc
gtcgacgccgacgcacgggacccgcggcgcaccatcacgggcgcggcgcaggaggcgtgg
ctgcgcgagggcttcgagacctcggtcgcccgctgggacctcatcacgcagcaggtgccg
ttcgtgcagtacgaccgctcctccggcccgctcctgtggggcgacatggactcatgggac
ggctacgtcgcctcgcgcgaccgcgtggtcagcgcgtggaccgcggcgggcgtccgcaac
cccgtggtgctcaccggtgacatccacgaggccttcgcctcggacatcaagcgggacttc
aacgacctctcctcggagtccgtgggcgtcgagctcatcaccacgtcgatcacctcgggc
ggcgacggctcggacgccgccgcggaggcgctcgcgtggaacccgcacatcaagttcaac
aacgacctgcgcggctacctccgcgtggacctctccgcccacatgctcgaggcccgcttc
cgcgtggtcgactacgtgagcgagctgggctcgtcggtgcgcacgcgcgcggtcttcggc
gtcggcgacggcgagcatcggctccaccggatcgcctga

DBGET integrated database retrieval system