KEGG   Micrococcus luteus: Mlut_21430Help
Entry
Mlut_21430        CDS       T00918                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mlu  Micrococcus luteus
Pathway
mlu00010  Glycolysis / Gluconeogenesis
mlu00071  Fatty acid degradation
mlu00350  Tyrosine metabolism
mlu00625  Chloroalkane and chloroalkene degradation
mlu00626  Naphthalene degradation
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01120  Microbial metabolism in diverse environments
mlu01130  Biosynthesis of antibiotics
mlu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_21430
  Lipid metabolism
   00071 Fatty acid degradation
    Mlut_21430
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mlut_21430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mlut_21430
   00626 Naphthalene degradation
    Mlut_21430
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mlut_21430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N AlaDh_PNT_C 2-Hacid_dh_C adh_short ELFV_dehydrog ThiF
Motif
Other DBs
NCBI-ProteinID: ACS31611
UniProt: C5C7C3
Position
complement(2295238..2296269)
Genome map
AA seq 343 aa AA seqDB search
MTTMKAAVVTQFGTEADVKEVERPTPGQHEALVKLISSGVCHTDLHAMEGDWPVKPTPPF
IPGHEGVGIVEEVGPDVENLKVGDMVGNAWLWRACGHCQYCRTGWETLCEEQVNGGYSVD
GSFGEYMLVDARYAPVIPEGADPMEVGPILCAGVTVYKGLKQTEVRPGQWVVISGIGGLG
HIAVQYAVAMGMRVVAVDVADDKLALASRHGAELTVNANVADPSVEIQEKIGGAHGVLVT
AVHPQAFGQAIAMTRRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEALE
FYAAGKIHPTFHTRPLTEINDVFDEMRHGKIEGRVVIDYAMQD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgaaggcagccgtcgtcacccagttcggcacagaggccgacgtcaaggag
gtcgagcgtccgacgcccggccagcacgaagcgctcgtgaagctcatctcctcgggcgtc
tgtcacacggacctgcacgcgatggagggcgactggccggtgaagccgaccccgccgttc
atcccgggccacgagggcgtgggcatcgtcgaggaggtcggacccgacgtcgagaacctc
aaggtcggggacatggtcggcaacgcgtggctgtggcgagcgtgcggccactgccagtac
tgccgcaccgggtgggagacgctgtgcgaggagcaggtcaacggcggctactccgtggac
ggctcgttcggtgagtacatgctcgtggacgcccgctacgcgcccgtgatccccgagggc
gcggacccgatggaggtcggcccgatcctgtgcgccggcgtcacggtgtacaaggggctg
aagcagaccgaggtgcggcccgggcagtgggtcgtgatctccggcatcggcggcctgggg
cacatcgcggtgcagtacgccgtggcgatgggcatgcgcgtggtggccgtggacgtcgcg
gacgacaagctggcgctcgcctcccggcacggcgcggagctgaccgtgaacgcgaacgtc
gcggacccctccgtggagatccaggagaagatcggcggcgcccacggcgtgctcgtcacg
gccgtgcacccgcaggcgttcggccaggccatcgcgatgacccgccgcggcggcacgatc
gtgttcaacggcctgcccccgggcgacttccccgcgccgatcttcgacatcgtcctcaag
ggcctgaccatccgcggttcgatcgtgggcacccggcaggacatggtcgaggcactcgag
ttctacgcggccgggaagatccacccgacgttccacacccgtccgctcaccgagatcaac
gacgtgttcgacgagatgcgccacggcaagatcgagggccgcgtcgtgatcgactacgcg
atgcaggactga

DBGET integrated database retrieval system