KEGG   Micrococcus luteus: Mlut_22150Help
Entry
Mlut_22150        CDS       T00918                                 

Definition
L-glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mlu  Micrococcus luteus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mlu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mlu00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mlu00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2373517..2374887)
Genome map
AA seq 456 aa AA seqDB search
MRHPIPDYLASLITELGAVNPGETAQYIPVLAEADPDRFGIALATPTGRLHFAGDADVEF
TIQSASKPFTYAAALVDRGFAAVDRQVGLNPSGEAFNELSLEAESHRPDNAMINAGALAV
HQLLVGPQASREERLDRAVEIMSLLAGRRLSVDRETYESEMAVSDRNLALAHMLRSYGVL
QDSAGEIVAGYVAQCAVLVTVKDLAVMGACLATDGIHPMTGERVLPSIVVRRVVSVMTSS
GMYDAAGQWLADVGIPAKSGVAGGVLGALPGRVGIGVFSPRLDEVGNSARGVLACRRLSE
DFRLHLMDGDSLGGTAVRFVEREGDRVFLHLQGVIRFGGAEAVLDALTDLRTGAEKPGTG
WDAAVYPRWQEAAADSAALSAATGGGAVHEAAAVAAQDENDGPIRTVVLNLERVDWIDDV
GRRLIAEGVRRLQADGVRVEVEDPERILPLEEAGAH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagacacccgatccccgactacctggcgagcctgatcaccgagctcggcgccgtgaac
ccgggcgagacggcccagtacatccccgtgctcgcggaggcggacccggaccgcttcggc
atcgcgctggccacccccaccgggcggctgcacttcgcgggggacgcggacgtggagttc
accatccagtccgcgtccaagccgttcacgtacgcggccgcgctcgtggaccggggcttc
gccgccgtggaccggcaggtggggttgaacccctcgggcgaggccttcaacgagctctcc
ctcgaggcggagtcgcaccgcccggacaacgccatgatcaacgccggcgcgctcgcggtg
caccagctgctcgtgggaccgcaggcgagccgggaggagcggctggaccgggccgtggag
atcatgtccctgctcgccgggcgtcggctctcggtggaccgggagacgtacgagtccgag
atggcggtctcggaccgcaacctcgccctggcgcacatgctccgcagctacggggtgctg
caggactccgccggggagatcgtggccgggtatgtggcgcagtgcgccgtgctcgtcacc
gtcaaggacctcgccgtgatgggcgcgtgtctggcgaccgacggcatccacccgatgacg
ggcgagcgagtgctgccgtccatcgtggtgcggcgcgtggtgtccgtgatgacctcctcc
ggcatgtacgacgccgccgggcagtggctcgccgacgtcgggatcccggccaagtccggg
gtggccggcggtgtgctcggcgcgctgccgggccgcgtggggatcggcgtgttctcgccg
cgcctggacgaggtgggcaactcggcgcgcggcgtgctggcgtgccgccgcctctccgag
gacttccggctgcacctcatggacggggacagcctgggcggcaccgccgtgcgcttcgtg
gaacgcgagggtgaccgcgtgttcctgcacctgcagggcgtgatccggttcggcggcgcc
gaggcggtgctggacgcgctcacggacctgcgcaccggtgcggagaagcccggcaccggc
tgggacgccgccgtctacccgcggtggcaggaggccgcggcggacagcgcggcgctctcg
gccgcgaccggcggcggggcggtgcacgaggccgccgccgtggccgcccaagacgagaac
gacgggcccatccgcaccgtggtgctcaacctcgagcgggtggactggatcgacgacgtc
ggccgacggctgatcgccgagggcgtgcgccggctgcaggccgacggcgtgcgcgtggag
gtcgaggatccggagcgcatcctgccgctggaggaggccggcgcccactga

DBGET integrated database retrieval system