KEGG   Micrococcus luteus: Mlut_22590Help
Entry
Mlut_22590        CDS       T00918                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mlut_22590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_22590
  Lipid metabolism
   00071 Fatty acid degradation
    Mlut_22590
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mlut_22590
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mlut_22590
   00626 Naphthalene degradation
    Mlut_22590
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mlut_22590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2412428..2413168
Genome map
AA seq 246 aa AA seqDB search
MVDVKAAGICHSDVSAIDDAGWMPLFPELPHTMGHENAGVISAVGEGMDHWQVGDRVGLA
PMNSKGEAIGYHSWEGGFGPKLRATDDNLVKLPDEVPFDLGAMATDAGLTAYHAVVAKGG
VKKGMKVGIIGLGGLGYIGAKVASLMGAEVYGAEVNPKTRELKDEMGLTAVAESILEFED
VGLELVVDYAGFGTKEDLAGIYELIQRGELNPPINHITQADMPDAIEKLREGGVIGRYIA
MYDDAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacgtgaaggccgcgggcatctgccactcggacgtctccgcgatcgacgacgcc
ggctggatgcccctcttccccgagctcccccacaccatgggccacgagaacgccggcgtg
atctccgccgtcggcgagggcatggaccactggcaggtcggcgaccgcgtcggcctggcc
cccatgaacagcaagggcgaggccatcggctaccacagctgggagggcggcttcggcccc
aagctccgcgccaccgacgacaacctggtgaagctgcccgacgaggtgcccttcgacctg
ggcgccatggccaccgacgccggcctgaccgcctaccacgccgtcgtcgccaagggcggg
gtgaagaagggcatgaaggtcggcatcatcggcctgggcgggctgggctacatcggcgcc
aaggtggcgtccctgatgggcgccgaagtgtacggcgccgaggtcaaccccaagacccgc
gagctcaaggacgagatgggcctgaccgccgtcgccgagtccatcctcgagttcgaggac
gtgggcctggagctggtggtggactacgccggcttcggcaccaaggaggacctggccggc
atctacgagctcatacagcgcggcgagctgaacccgccgatcaaccacatcacccaggcg
gacatgccggacgcgatcgagaagctgcgcgagggcggcgtgatcggccgctacatcgcg
atgtacgacgacgcgaagtga

DBGET integrated database retrieval system