KEGG   Micrococcus luteus: Mlut_23050Help
Entry
Mlut_23050        CDS       T00918                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mlu  Micrococcus luteus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mlut_23050
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mlut_23050
Exosome [BR:mlu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mlut_23050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2456909..2458441
Genome map
AA seq 510 aa AA seqDB search
MTTPRYVMAIDQGTTSTRAILFDHSGAIVSTGQREHEQIFPRAGWVEHDPVEIWKNTREV
IGEALARAEVTRHDVAAVGITNQRETTVVWDRNTGKPVYNAIVWQDTRTDRLCERLAGDV
GADRYKERVGLPLATYFSGPKVAWILENVDGAREAAENGDLIFGTTDSWLVWNLTGGGEG
GRHVTDVTNASRTMLMNLDTLDWNEEICADMGIPMSMLPEIVSSSAEVGTVSGQQLLRET
PITGILGDQHAATFGQACFEVGQAKNTYGTGNFMLINTGEEPVHSDNGLLTTVAYRIGDQ
KPVYALEGSIAVTGSLIQWLRDNLGMIGSAPEVETLAAGVEDNGGVYFVPAFSGLFAPHW
DAAARGVMVGMTRYVNKGHIARAALEATAFQSREVLDAMNADSGVDLTELKVDGGMVANE
LLMQFQADLLRVPVVRPKVIETTALGAAYAAGLAVGFWASQDELVANWEEDKRWEPTTDE
EEVERALRLWKKAVERSRDWVDEDVESAQG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccgctacgtgatggccatcgaccagggcaccacgtccacgcgcgcgatc
ctcttcgaccacagtggggccatcgtgtccactggtcagcgcgaacacgagcagatcttc
ccgcgcgccggctgggtggagcacgacccggtggagatctggaagaacacccgcgaggtc
atcggcgaggccctggcccgcgccgaggtgacccggcacgacgtcgccgccgtgggcatc
acgaaccagcgtgagaccaccgtggtgtgggaccgcaacaccggcaagccggtgtacaac
gccatcgtgtggcaggacacccgcaccgaccgcctctgcgagcgcctcgccggcgacgtc
ggcgcggaccgctacaaggagcgcgtcgggctgcccctggccacgtacttctccggcccc
aaggtggcctggattctggagaacgtggacggtgcccgggaggccgccgagaacggcgac
ctcatcttcggcaccacggactcgtggctcgtgtggaatctcaccggcggcggcgagggc
ggccggcacgtcaccgacgtcaccaacgcctcccgcaccatgctgatgaacctggacacc
ctcgactggaacgaggagatctgcgcggacatgggcatcccgatgtccatgcttccggag
atcgtcagctcctccgccgaggtgggcaccgtatccggccagcagctgctgcgcgagacg
ccgatcaccggcatcctgggcgaccagcacgcggcgaccttcggccaggcgtgcttcgag
gtcggccaggccaagaacacgtacggcaccggcaacttcatgctgatcaacaccggcgag
gagccggtgcactcggacaacggcctgctcaccacggtggcgtaccgcattggcgaccag
aagccggtgtacgcgctggagggctcgatcgccgtcaccggctcgctgatccagtggctg
cgggacaacctcgggatgatcggcagcgccccggaggtcgagaccctggccgccggcgtg
gaggacaacggcggcgtgtacttcgtccccgcgttctccggcctcttcgccccgcactgg
gacgccgcggcccgcggcgtcatggtgggcatgacccgttacgtcaacaaggggcacatc
gcccgcgcggcgctcgaggccaccgccttccagagccgcgaggtcctggacgccatgaac
gcggactccggcgtggacctcaccgaactgaaggtcgacggtggcatggtcgccaacgag
ctgctcatgcagttccaggcggacctgctgcgcgtgcccgtcgtgcgccccaaggtcatc
gagaccaccgctctcggcgccgcctacgccgcaggcctggcggtggggttctgggcgtcc
caggacgagctcgtggccaactgggaagaggacaagcgctgggagcccaccacggacgag
gaggaggttgagcgcgccctgcggctgtggaagaaggccgtggaacgctcccgcgactgg
gtcgacgaggacgtcgagtcggcccagggctga

DBGET integrated database retrieval system