KEGG   Micrococcus luteus: Mlut_23050Help
Entry
Mlut_23050        CDS       T00918                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mlu  Micrococcus luteus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mlu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2456909..2458441
Genome map
AA seq 510 aa AA seqDB search
MTTPRYVMAIDQGTTSTRAILFDHSGAIVSTGQREHEQIFPRAGWVEHDPVEIWKNTREV
IGEALARAEVTRHDVAAVGITNQRETTVVWDRNTGKPVYNAIVWQDTRTDRLCERLAGDV
GADRYKERVGLPLATYFSGPKVAWILENVDGAREAAENGDLIFGTTDSWLVWNLTGGGEG
GRHVTDVTNASRTMLMNLDTLDWNEEICADMGIPMSMLPEIVSSSAEVGTVSGQQLLRET
PITGILGDQHAATFGQACFEVGQAKNTYGTGNFMLINTGEEPVHSDNGLLTTVAYRIGDQ
KPVYALEGSIAVTGSLIQWLRDNLGMIGSAPEVETLAAGVEDNGGVYFVPAFSGLFAPHW
DAAARGVMVGMTRYVNKGHIARAALEATAFQSREVLDAMNADSGVDLTELKVDGGMVANE
LLMQFQADLLRVPVVRPKVIETTALGAAYAAGLAVGFWASQDELVANWEEDKRWEPTTDE
EEVERALRLWKKAVERSRDWVDEDVESAQG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccgctacgtgatggccatcgaccagggcaccacgtccacgcgcgcgatc
ctcttcgaccacagtggggccatcgtgtccactggtcagcgcgaacacgagcagatcttc
ccgcgcgccggctgggtggagcacgacccggtggagatctggaagaacacccgcgaggtc
atcggcgaggccctggcccgcgccgaggtgacccggcacgacgtcgccgccgtgggcatc
acgaaccagcgtgagaccaccgtggtgtgggaccgcaacaccggcaagccggtgtacaac
gccatcgtgtggcaggacacccgcaccgaccgcctctgcgagcgcctcgccggcgacgtc
ggcgcggaccgctacaaggagcgcgtcgggctgcccctggccacgtacttctccggcccc
aaggtggcctggattctggagaacgtggacggtgcccgggaggccgccgagaacggcgac
ctcatcttcggcaccacggactcgtggctcgtgtggaatctcaccggcggcggcgagggc
ggccggcacgtcaccgacgtcaccaacgcctcccgcaccatgctgatgaacctggacacc
ctcgactggaacgaggagatctgcgcggacatgggcatcccgatgtccatgcttccggag
atcgtcagctcctccgccgaggtgggcaccgtatccggccagcagctgctgcgcgagacg
ccgatcaccggcatcctgggcgaccagcacgcggcgaccttcggccaggcgtgcttcgag
gtcggccaggccaagaacacgtacggcaccggcaacttcatgctgatcaacaccggcgag
gagccggtgcactcggacaacggcctgctcaccacggtggcgtaccgcattggcgaccag
aagccggtgtacgcgctggagggctcgatcgccgtcaccggctcgctgatccagtggctg
cgggacaacctcgggatgatcggcagcgccccggaggtcgagaccctggccgccggcgtg
gaggacaacggcggcgtgtacttcgtccccgcgttctccggcctcttcgccccgcactgg
gacgccgcggcccgcggcgtcatggtgggcatgacccgttacgtcaacaaggggcacatc
gcccgcgcggcgctcgaggccaccgccttccagagccgcgaggtcctggacgccatgaac
gcggactccggcgtggacctcaccgaactgaaggtcgacggtggcatggtcgccaacgag
ctgctcatgcagttccaggcggacctgctgcgcgtgcccgtcgtgcgccccaaggtcatc
gagaccaccgctctcggcgccgcctacgccgcaggcctggcggtggggttctgggcgtcc
caggacgagctcgtggccaactgggaagaggacaagcgctgggagcccaccacggacgag
gaggaggttgagcgcgccctgcggctgtggaagaaggccgtggaacgctcccgcgactgg
gtcgacgaggacgtcgagtcggcccagggctga

DBGET integrated database retrieval system