KEGG   Methanosarcina mazei Go1: MM_0087Help
Entry
MM_0087           CDS       T00082                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mma00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112009..113532)
Genome map
AA seq 507 aa AA seqDB search
MMQLKLEHYNIKIGQHKVLLNIVDAKELGVNPGDRVRIRGHQSLSAIVDTTDDMVPPGTL
GVFTEVYEHFEDWDKPVEVVPSFRSKSAAVIKKMLDKKPVVQDEIKMLVSDIVDENLSDV
ELSAFITASYIHGMTDDEVEWLTRAMIDTGDTIEFDTHPIMDKHSIGGVPGNKISLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEVLSPVEFSSQEVKEITEKVGGALVWGGATNIA
PADDKLIKIEYPLSIDPYYQMLASIMAKKGAIGADNVVMDIPVGPGTKVPTVQEGQKLAR
DLINLGHRLGMNVECAITYGSSPIGRRVGPSLEVKEAMKVLESMEGPNSLIEKSAALAGI
LLEMGGAAPRDQGKELALETLRSGKALEKMKQIIEAQGGDPNIKSDDIQTGQYTADIFAS
TDGYVMEFDNKWIIEIARLAGAPNDKGAGVAIHKKRGEQVKKGDPILTIYAEKEIKLDNA
LATAQRTNPIIVEGMLLRRIPGTYGFQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcagttgaagctggaacattataatataaaaattggacagcacaaagtgttgctg
aatattgtcgatgcgaaagaactgggagtcaaccccggagatagggtccgcatccggggg
catcaaagcctttctgccattgtggacacaactgatgacatggttcctccgggaactctt
ggtgtctttactgaagtttatgaacatttcgaagactgggataagccggtagaagttgtc
ccttcttttcgctcaaaatccgcagccgttatcaaaaaaatgctggacaaaaagcctgtt
gtacaggacgagatcaaaatgcttgtaagcgatatcgttgatgaaaacctgagcgatgtc
gagctttctgcctttataacagcttcatatatccacgggatgaccgatgacgaagtcgaa
tggctgacaagggcaatgatagatacaggagacactatcgaattcgatacgcaccctatt
atggacaagcactcgataggtggggttcccggaaacaagatttctctccttattgtcccc
atagttgccgcaaacgggctgctcatcccaaagaccagttcaagggctatcacgggtgca
ggcgggactgccgaccttatggaagtgctctctcctgttgagttcagctcgcaggaagta
aaggagataaccgaaaaggtaggaggagcactcgtctggggcggagctacaaatattgcg
cctgcagatgataagctcatcaaaattgaatatcccctgtccattgacccttattaccag
atgcttgcctcaatcatggcaaaaaaaggagccatcggggcagacaatgtggtaatggat
atccctgtcgggccgggcacgaaggtccccacagttcaggaaggacagaaactggccaga
gacctcatcaacctcgggcacagacttggaatgaatgttgagtgcgctattacttacggt
tcgtctcctatcgggaggagagtaggaccttctctggaagtaaaggaagccatgaaagtc
cttgagagcatggaaggtccaaacagccttattgaaaagagcgcggctctcgcaggcatt
cttcttgaaatgggaggggcagctccgagagatcagggaaaagagcttgcacttgaaact
ctcaggagtggaaaagctctcgagaaaatgaaacagatcattgaagcccagggaggagac
ccgaacatcaagtccgatgatattcagacagggcagtacactgctgatatttttgcttct
acggacgggtatgttatggagttcgacaacaaatggataattgagattgccaggcttgca
ggagctccaaatgacaagggagctggagttgcaatacacaaaaagagaggagaacaggtt
aaaaaaggagatccgattctcaccatatatgccgaaaaagagatcaaacttgataatgca
ctggcaacggcacagaggacaaacccgataatagtcgaaggcatgcttctcagaagaatt
cctggaacttatgggttccagtaa

DBGET integrated database retrieval system