KEGG   Methanosarcina mazei Go1: MM_0111Help
Entry
MM_0111           CDS       T00082                                 

Definition
ribosomal protein S6 modification protein
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mma  Methanosarcina mazei Go1
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MM_0111
Enzymes [BR:mma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MM_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137429..138403
Genome map
AA seq 324 aa AA seqDB search
MKKIGIAITDPEDWTARALIKAAKEKGFSPLVFDLSDAEVRIGSGISEPASIFKAGEVLL
SDLDALIVRDVGAGAFEGVSFRFDILRELEAEGVSVINSPEAIQNAANKYHASYLLAKAG
LPVPETVAVQSLEAALKVISEFGDAVIKPVFGYKGKDIARVKNREIRFSDRKIEPAPVEE
ILEKLLEEKGMLYIQEFIENPGRDIRAFVVGGTAIGAIYRKAAAGSWVNNLSQGGSSDRC
VLTDEQEKIAEKASLALGTTFAGIDIIEGTEESEENKKTEGMSSENRKSPRILEVNGTPS
GKGIFDAWGINPADHILEYLKNIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagggattgcaattactgatcctgaagactggacagcccgggcactcatc
aaagcggcaaaagaaaaaggtttttcccctcttgtttttgacctcagtgatgcggaagtc
aggataggttcaggcatttctgagccagcctccatttttaaagcaggtgaagttctgctc
tcagaccttgatgcgcttattgtaagggatgtgggtgcaggggcttttgaaggagtttca
ttcaggtttgacatactcagggaactcgaggcagaaggggtttcggttataaactctcca
gaagccatccagaatgcggcaaacaaataccatgcttcttatcttcttgcaaaagccggg
cttcctgtgcctgaaactgtagctgtccagagtcttgaggcagcattaaaagtaatatca
gaattcggggacgctgttataaaacctgtttttggatataaagggaaggatattgcaagg
gtaaagaaccgggaaatccggttttcagaccgaaagattgagcctgcacctgttgaggaa
attctcgaaaagctgcttgaagagaaagggatgctctatattcaggaatttatagaaaac
ccggggagagacataagggcttttgttgtgggcggcactgccataggagctatttataga
aaagctgctgctggctcctgggtgaacaacctgagccagggaggaagttcggatagatgc
gttcttaccgatgagcaggaaaaaattgccgaaaaagcttcacttgcgcttggaacgaca
tttgcaggcattgatattatagaaggcacggaagaatcggaagaaaacaaaaaaaccgaa
ggcatgagcagtgaaaacaggaaaagtccaaggatacttgaagtcaacggaacaccttca
ggaaaagggatttttgatgcctggggaataaatcccgcagaccacatcctggaatacctt
aaaaatattttatga

DBGET integrated database retrieval system