KEGG   Methanosarcina mazei Go1: MM_0255Help
Entry
MM_0255           CDS       T00082                                 

Definition
methyltransferase (EC:2.1.1.86)
Orthology
K00577  
tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mma  Methanosarcina mazei Go1
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mma01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340711..341229
Genome map
AA seq 172 aa AA seqDB search
MVTLASHLDACPDAAIWGSSKTENLGVEKIIVNVISNSNIRYVLVCGTESRGHLAGHSLL
AIHANGIDEQGRITGSQGAIPFIENISGTAVERFQQQVTVLNRIGLNDPEEIRRIVEDYR
DKGEAYPEEPMLVCAPKKRQTSFAVPTSGDVIISGEFVMDSKAGIIYTAESL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactcttgcaagccaccttgatgcctgccctgatgctgctatctggggcagttca
aaaaccgaaaacctgggagtagaaaagataatagtaaatgtaatttcaaactccaatatc
aggtacgtcctggtctgcggaaccgagtcaagaggccacctggcagggcattctctcctc
gcaatccatgcaaacggaattgatgaacagggcaggattaccggttcacagggagcaatt
ccctttatagaaaacatatccggaactgcagtcgaacgcttccagcagcaggttacagtt
ctcaatagaattgggctgaatgaccctgaagagatcaggaggattgttgaggactacagg
gataaaggagaagcgtaccctgaagagcccatgctcgtctgcgctcctaaaaaaaggcag
acttcttttgcagtccccacttcaggagatgtaataatttcaggggaattcgtaatggat
tcaaaagcaggaataatctatactgcggaaagcctctga

DBGET integrated database retrieval system