KEGG   Methanosarcina mazei Go1: MM_0282Help
Entry
MM_0282           CDS       T00082                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MM_0282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_0282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MM_0282
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MM_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378966..380183
Genome map
AA seq 405 aa AA seqDB search
MYHLKCIECGAEYSKDEVIYTCSKCDGLLDVIYDYSSIKLDMEKLKTECPSVWKYAELLP
IEREPVTIHEGGTPLYRCDRLAEKIGIKELYVKHEGMNPTGSFKDRGMTVGVTKALELGM
STVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA
LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLGFKVPDRIVLPVGNAGNITAIY
KGFREFKLLGITDSLPKMTGIQAAGSCPIVKAIKNGAPEITPEENPETVATAIRIGNPVN
ATKALNAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLKKLVDMGVIGR
DETVVCITTGHLLKDPQTVIDICEEPTVVDANIESIREAIFGKGK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctaaaatgtatcgagtgcggtgcagagtattcaaaagatgaagtaatctat
acatgcagcaaatgcgatgggctgcttgatgttatttatgattattcctcaattaaactc
gacatggaaaaattaaagaccgaatgtccttcggtctggaaatatgcagaacttctcccc
atagaaagagaacctgtgaccatacatgaaggcgggaccccactttacagatgcgatcgc
cttgccgaaaagatagggattaaagaactctatgtaaaacatgaaggaatgaacccgact
ggctcatttaaagatagagggatgactgttggggttacaaaagcacttgaactcggaatg
agtaccgtcgcctgtgcatcaaccgggaacacgtcggcagcccttgcaatctatggggca
aaagcaggaatacctgtggttgtgcttcttccggctggaaaagttgcccttggaaaggta
gcccaggcacttatgcacggggcaaaagtcctcagcatccgcggaaactttgatgatgca
ctcgctcttgtgcgcactctctgctcccaggaaaagatctacctcttaaactcgatcaac
ccttacaggctggaaggccagaagaccatcggcttcgagattgcagaccagctcggcttc
aaagttcctgacaggattgtcctgcccgtaggaaatgcaggcaatatcactgctatctac
aagggtttcagggagttcaagctccttggcatcacggactccctcccgaagatgacggga
attcaggcagcaggctcctgccccatagtaaaagccattaaaaacggggctccggaaatc
actcccgaagagaacccggagacggttgcaacggcaatcaggataggaaaccctgtgaac
gcaacaaaagccctgaacgctataagggaatccggcggtactgcggagtccgtaactgat
gaagaaatccttgcagcccagaaagaccttgcaaggcttgagggtataggagtcgaacct
gcaagtgcagcctcggtagctggtcttaagaaactcgttgacatgggagtcataggcagg
gacgaaacagtagtctgcattaccacaggccacctccttaaagacccccagaccgttatt
gacatctgtgaggaacctactgtcgttgatgcaaacatcgagtccatccgggaagcgatt
ttcgggaagggaaaataa

DBGET integrated database retrieval system