KEGG   Methanosarcina mazei Go1: MM_0282Help
Entry
MM_0282           CDS       T00082                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MM_0282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_0282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MM_0282
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MM_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378966..380183
Genome map
AA seq 405 aa AA seqDB search
MYHLKCIECGAEYSKDEVIYTCSKCDGLLDVIYDYSSIKLDMEKLKTECPSVWKYAELLP
IEREPVTIHEGGTPLYRCDRLAEKIGIKELYVKHEGMNPTGSFKDRGMTVGVTKALELGM
STVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA
LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLGFKVPDRIVLPVGNAGNITAIY
KGFREFKLLGITDSLPKMTGIQAAGSCPIVKAIKNGAPEITPEENPETVATAIRIGNPVN
ATKALNAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLKKLVDMGVIGR
DETVVCITTGHLLKDPQTVIDICEEPTVVDANIESIREAIFGKGK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctaaaatgtatcgagtgcggtgcagagtattcaaaagatgaagtaatctat
acatgcagcaaatgcgatgggctgcttgatgttatttatgattattcctcaattaaactc
gacatggaaaaattaaagaccgaatgtccttcggtctggaaatatgcagaacttctcccc
atagaaagagaacctgtgaccatacatgaaggcgggaccccactttacagatgcgatcgc
cttgccgaaaagatagggattaaagaactctatgtaaaacatgaaggaatgaacccgact
ggctcatttaaagatagagggatgactgttggggttacaaaagcacttgaactcggaatg
agtaccgtcgcctgtgcatcaaccgggaacacgtcggcagcccttgcaatctatggggca
aaagcaggaatacctgtggttgtgcttcttccggctggaaaagttgcccttggaaaggta
gcccaggcacttatgcacggggcaaaagtcctcagcatccgcggaaactttgatgatgca
ctcgctcttgtgcgcactctctgctcccaggaaaagatctacctcttaaactcgatcaac
ccttacaggctggaaggccagaagaccatcggcttcgagattgcagaccagctcggcttc
aaagttcctgacaggattgtcctgcccgtaggaaatgcaggcaatatcactgctatctac
aagggtttcagggagttcaagctccttggcatcacggactccctcccgaagatgacggga
attcaggcagcaggctcctgccccatagtaaaagccattaaaaacggggctccggaaatc
actcccgaagagaacccggagacggttgcaacggcaatcaggataggaaaccctgtgaac
gcaacaaaagccctgaacgctataagggaatccggcggtactgcggagtccgtaactgat
gaagaaatccttgcagcccagaaagaccttgcaaggcttgagggtataggagtcgaacct
gcaagtgcagcctcggtagctggtcttaagaaactcgttgacatgggagtcataggcagg
gacgaaacagtagtctgcattaccacaggccacctccttaaagacccccagaccgttatt
gacatctgtgaggaacctactgtcgttgatgcaaacatcgagtccatccgggaagcgatt
ttcgggaagggaaaataa

DBGET integrated database retrieval system