KEGG   Methanosarcina mazei Go1: MM_0282Help
Entry
MM_0282           CDS       T00082                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mma01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mma00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mma00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378966..380183
Genome map
AA seq 405 aa AA seqDB search
MYHLKCIECGAEYSKDEVIYTCSKCDGLLDVIYDYSSIKLDMEKLKTECPSVWKYAELLP
IEREPVTIHEGGTPLYRCDRLAEKIGIKELYVKHEGMNPTGSFKDRGMTVGVTKALELGM
STVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA
LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLGFKVPDRIVLPVGNAGNITAIY
KGFREFKLLGITDSLPKMTGIQAAGSCPIVKAIKNGAPEITPEENPETVATAIRIGNPVN
ATKALNAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLKKLVDMGVIGR
DETVVCITTGHLLKDPQTVIDICEEPTVVDANIESIREAIFGKGK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctaaaatgtatcgagtgcggtgcagagtattcaaaagatgaagtaatctat
acatgcagcaaatgcgatgggctgcttgatgttatttatgattattcctcaattaaactc
gacatggaaaaattaaagaccgaatgtccttcggtctggaaatatgcagaacttctcccc
atagaaagagaacctgtgaccatacatgaaggcgggaccccactttacagatgcgatcgc
cttgccgaaaagatagggattaaagaactctatgtaaaacatgaaggaatgaacccgact
ggctcatttaaagatagagggatgactgttggggttacaaaagcacttgaactcggaatg
agtaccgtcgcctgtgcatcaaccgggaacacgtcggcagcccttgcaatctatggggca
aaagcaggaatacctgtggttgtgcttcttccggctggaaaagttgcccttggaaaggta
gcccaggcacttatgcacggggcaaaagtcctcagcatccgcggaaactttgatgatgca
ctcgctcttgtgcgcactctctgctcccaggaaaagatctacctcttaaactcgatcaac
ccttacaggctggaaggccagaagaccatcggcttcgagattgcagaccagctcggcttc
aaagttcctgacaggattgtcctgcccgtaggaaatgcaggcaatatcactgctatctac
aagggtttcagggagttcaagctccttggcatcacggactccctcccgaagatgacggga
attcaggcagcaggctcctgccccatagtaaaagccattaaaaacggggctccggaaatc
actcccgaagagaacccggagacggttgcaacggcaatcaggataggaaaccctgtgaac
gcaacaaaagccctgaacgctataagggaatccggcggtactgcggagtccgtaactgat
gaagaaatccttgcagcccagaaagaccttgcaaggcttgagggtataggagtcgaacct
gcaagtgcagcctcggtagctggtcttaagaaactcgttgacatgggagtcataggcagg
gacgaaacagtagtctgcattaccacaggccacctccttaaagacccccagaccgttatt
gacatctgtgaggaacctactgtcgttgatgcaaacatcgagtccatccgggaagcgatt
ttcgggaagggaaaataa

DBGET integrated database retrieval system