KEGG   Methanosarcina mazei Go1: MM_0337Help
Entry
MM_0337           CDS       T00082                                 

Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MM_0337
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_0337
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MM_0337
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MM_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(443958..445286)
Genome map
AA seq 442 aa AA seqDB search
MYRNVTQEIFMEQTKIILDENEMPKRWYNVLSDLPSPIDPPLDPRTWQPINPEALEPIFA
KELIRQEMSSDRYIDIPAEILDVYRLWRPSPLFRAHQLEKDLKTPAKIYYKYEGVSPAGS
HKTNTSIAQAYYNMKEGTERLTTETGAGQWGSALSLACNYFDLECKVYMVRSSYYQKPYR
KSLMTLWGGNVVPSPSPDTEFGRKILKEQPDTPGSLGIAISEAVEDAIAHDNTKYTLGSV
LNHVVLHQTVIGAECKKQLEQVEEYPDVVIGCCGGGSNLGGIGLEFIKDRLEGKHNARVV
AVEPSACPSLTKGEYRYDFGDTAEMTPLLKMYTLGHKHIPPAIHAGGLRYHGDSPIISKL
CAEGLMEAVSYGQKEVFDAAVQFARTEGIVPAPESSHAIRCAIDEALEAKQKGEEKVILF
NLSGHGHFDMASYDKYFSGELE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtacagaaacgttacgcaggagattttcatggagcagacaaaaattatccttgacgaa
aatgaaatgccgaagagatggtacaacgtcctttcagacctgccgtctccaatagacccg
cctctggacccaagaacctggcagcctataaaccctgaggctcttgagcctatttttgca
aaggaactgatcaggcaggaaatgagcagtgacaggtacatcgatatccctgcagaaata
ctcgatgtttacaggctctggaggccaagccccctcttcagggctcaccagcttgaaaag
gacctcaagacccctgcaaaaatatattataagtatgaaggggtcagccccgcaggcagc
cacaagacaaatacctccattgcccaggcctactacaatatgaaagaaggcacggaacgg
ctcacaaccgagaccggagcaggacagtggggaagtgcactttctcttgcctgcaactac
tttgacctcgaatgcaaggtctatatggttcgttcaagttattaccagaaaccttacaga
aaatcccttatgactctctggggaggaaatgtcgtgccttccccgagtcctgatacggag
tttggaagaaaaatcctgaaggagcagcctgacacgcccgggagcctcgggattgcaatc
agtgaggctgtagaggacgcaatagcccatgataatacaaaatacacgcttggaagcgtg
ctgaaccatgttgttctccatcagaccgtgataggagctgaatgtaaaaaacagcttgaa
caggtcgaagagtatcctgatgtggttatagggtgctgcggaggagggagcaacctcgga
gggatcggactcgaattcataaaagacaggcttgaaggaaagcacaatgcaagagtggtc
gcagtcgagccttcagcatgtccttccctgacaaaaggagaatacagatatgacttcgga
gacactgccgagatgacgcctcttctcaagatgtacactctcggacacaagcacatacca
cctgccatccatgcaggaggactccgttatcacggcgactctcccattataagcaaactc
tgtgccgaagggctcatggaagcggtttcttatggccagaaagaggtcttcgatgcagct
gtccagtttgccaggacggaaggaatagtgcctgcacctgaatcttcccatgcaatacgc
tgtgcgattgatgaagcccttgaagctaagcagaaaggagaagaaaaggtaattctcttc
aaccttagcgggcacgggcactttgacatggcttcctacgacaaatatttcagcggagaa
cttgagtga

DBGET integrated database retrieval system