KEGG   Methanosarcina mazei Go1: MM_0440Help
Entry
MM_0440           CDS       T00082                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mma  Methanosarcina mazei Go1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(559424..560659)
Genome map
AA seq 411 aa AA seqDB search
MSKMVINTDICGIKVGDQYPAHVMGIINLSPESFYNGSIISPDSTLETAQKMVEDGATFL
DIGARSTWRFSEPISRKEELDRLLPVLEALEGNVDAVVSVDTMFSEIAEEVLKRGAQVIN
DVSGFTADPRMMEVVADNGCPAVVMASKKAPGDLLGMDAIIEALDSIIQAAESRGIASES
LILDPAIGRWMDEKQPMYDFETLDDFERLKIFEKPLLAALSRKSFIGEVLGKPADERLYG
SLAAAAIAVYKGAHIIRTHDVPATSDVVRLSGALRSRTSVVKEGRYEVSVLEVKTPQDAG
IAMRNIGATRVGSQVMQGKSVHLVLKIRNLTTTEALIIKQEMLARGGDAALARDAVSHET
EATDVLVMGTLLQFERLARKLDGQARSLPLIAEMIRECISNRTNLEYRYLR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaaaatggtaattaatactgatatttgcggtataaaagtaggagaccagtatcct
gcacatgtaatgggtattattaatctgagccctgagtctttttacaatggttcaattata
agtcctgactctacacttgagaccgcccaaaaaatggttgaagacggagcaactttcctg
gacataggtgcccggtcaacatggcgcttttcagaacctattagcagaaaagaagaactt
gaccgcttacttcccgtgcttgaagctctggaaggcaatgtggacgctgtggtctcagtt
gataccatgttttccgaaatagcagaggaagttcttaaaagaggggcacaggtcataaac
gatgtttccggctttacggcggatcccaggatgatggaagtggtggcagacaacggctgt
ccggctgtggttatggcttccaaaaaagcccccggagacctcctgggcatggatgccatt
attgaagcccttgattccattatacaggctgctgagtccaggggcatagcgtctgaaagc
ctcatccttgaccctgcgataggaagatggatggacgagaagcagcccatgtacgacttt
gagactttggacgatttcgagcgccttaagatctttgaaaaacctctgcttgcagccctt
tcaagaaaatccttcataggtgaagtccttggaaagccggcagatgaaaggctctatggc
agcctggctgcagcggcgattgctgtctataaaggcgcacatattatccgtacacacgat
gtacctgcaacttctgacgttgtcaggctttcaggagccctgaggagccgcacaagtgtt
gtaaaggaaggcaggtatgaagtttcggtgcttgaagtgaaaaccccgcaggacgcgggc
attgcaatgagaaatatcggagccacaagagtcggttcacaggttatgcagggaaaaagc
gttcatcttgttttaaaaataaggaaccttacaaccacggaagctctgataattaaacag
gagatgcttgcaaggggaggagatgcagccctcgccagggatgctgtttcccatgaaacg
gaagctaccgatgttcttgttatgggaaccctgctgcaatttgagcgtcttgcacgtaaa
ctggatgggcaggcccgttctttgccgcttatcgccgagatgattcgcgaatgcatatct
aatcggactaacctggaatacagatatttgaggtaa

DBGET integrated database retrieval system