KEGG   Methanosarcina mazei Go1: MM_0513Help
Entry
MM_0513           CDS       T00082                                 

Definition
cobyrinic acid a,c-diamide synthase
Orthology
K02224  
cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(637715..639211)
Genome map
AA seq 498 aa AA seqDB search
MSQSNHPGGKDAGSIPRVLISADRSSSGKTTISMGLMAALVSRGYKVQPFKVALDYIDPS
YHTEITGRFCRNLDGYLMDEHGILDVYTHACETGGGADIAIIEGVRGLFEGFESLSDVGS
TAQIAKILKCPVVFVINARSITRSAAALIGGYKNFDPDVEIAGVILNNIGGRRHAQKAKE
AIEHYTGVPVLGIIPRDPSMQISMRHLGLMPALEGRRRFGDGGFENRLHGIEEIINKGID
VDRFLGIAESAKPLTALENSIFSPAVNENSQKPKIGVALDEAFNFYYRDNIDLLEIAGAE
IVYFSPVNDPGLPEVDGLYIGGGYPELFAAELEANETMRKSIKEASAAGMPIYAECGGLM
YLTEKISTGVPGKGTYHDASMPESTYSMVGALPGHTIMGQTRVVSYNIGTLARDCPIGKK
GNSFKGHEFHHSEILEIPDDAEFAIALTRGTGIRGDRDGLIVNNTIGSYAHLHGVAYREL
AGSLVEAARKFRDSRVSS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaagcaaccatccgggcggaaaagatgccgggagcattcccagagtcctgatt
tccgcagaccgctcttcttcaggcaagaccacaatttccatggggctcatggctgccctt
gtctcacgagggtataaagtccagcctttcaaggtcgcccttgactatatcgaccccagt
taccataccgagatcacgggcaggttctgcaggaaccttgacggataccttatggatgag
cacggaattcttgatgtttacacccatgcctgtgaaaccggtggtggggccgatattgca
attattgaaggtgttcgcgggctttttgagggttttgaaagtctaagcgacgtcgggagc
actgcccagattgcaaagatccttaaatgccctgtggttttcgtaatcaatgctcgcagc
attacacgctcagctgctgctctcataggcgggtataagaacttcgaccccgatgttgag
atcgcgggagtaatcctcaataatatcggaggccgccgccacgcacagaaggcaaaagag
gcaatagaacattataccggcgtgcctgttttagggatcattccaagggacccttcgatg
cagatttccatgcggcacctcgggcttatgccggctctggaaggaaggcggaggttcgga
gacggagggtttgagaacaggctacacggcattgaagagattatcaataaaggaattgat
gtggaccgttttctgggaattgcagaaagtgcaaaacctctgacagccctggaaaacagc
atcttttcccctgccgtaaatgaaaattctcaaaagccgaagataggggttgctcttgat
gaagcttttaatttctactaccgcgacaatatcgacctcctggaaattgcaggtgctgag
attgtttacttcagccctgtaaatgaccccgggcttcctgaggttgacgggctttacata
ggaggcggctaccccgaactttttgcagccgaacttgaagccaacgaaaccatgcggaaa
tccatcaaagaagcttccgctgcaggtatgcccatatatgccgaatgcggagggctcatg
taccttacggaaaaaatcagcaccggtgtccccgggaaaggcacttatcacgatgcttcc
atgccagagtccacctattcaatggtcggggctcttccgggccacacaattatgggacag
acaagggttgtcagttacaatatcgggacccttgcaagggactgccctatagggaaaaaa
ggcaacagcttcaaggggcacgagttccaccactctgaaatccttgaaattccggatgat
gcggaatttgcaatagcactcacaaggggcacggggataagaggcgacagggacgggctt
atagttaacaataccattggctcttatgcccaccttcacggagttgcatacagggagctt
gccggctctctagtcgaagctgcaagaaagttcagggattccagggtttccagctaa

DBGET integrated database retrieval system