KEGG   Methanosarcina mazei Go1: MM_0572Help
Entry
MM_0572           CDS       T00082                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MM_0572
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MM_0572
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MM_0572
Enzymes [BR:mma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MM_0572
Exosome [BR:mma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MM_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(697918..699669)
Genome map
AA seq 583 aa AA seqDB search
MDTKETNVLLTLLVGLLLLGNAGSAAAVEDDSNSKDFSGNYTCLTDSLKCKSCPESEAKI
KNVIILVPDGCFQSVQTLARWYSGSPLMLDEMVAGTVSTYSTDSVITDSSSAASAFATGY
KTTNGFVSVGPSNASVLSILENPSEDMQYRPLATVLEGSKLEGKATGLVATSRVTHATPA
AFASHVDNRDNENEIMEQMVYENVDVVFGGGSRHLVPEEEGGKRTDRENLTEVLLDRGYQ
YVDSRDEMLNLSSGKAWGLFASSHMAPDIDRTELVPEEPSLSEMTGKALELLSQDKDGFF
LLVEGSQVDWANHANDPVYAVTDFLAFDEAVKVAVEFAEQDGHTLVLAFPDHNTGGMTIG
SDSDSNYTSTTIEDVIDPLKSMKLSSAGIAEKIGTDVSSENIKTQLKTWWGIDATDDEVT
EILEIYNNGEGLSLDYAISEVIDQNHTVIGWTTHGHCGEDVPLWAYGPDHPAGHLDNTEI
AGYIAEKAGFNLEETNRYLFVEVSEVFSRDNGDGKLDENEYLLDLTSSLNPVLRIGDAEL
PVSTNILIKQGVTYELEGIVVYAPATGKVYIPSEVLSLVNGKK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatactaaagaaacaaatgttctactaaccctcctcgtagggcttctgctactggga
aatgctggttctgcagcagctgtggaagatgattcaaatagcaaagatttttcaggtaat
tatacctgtctcactgattccttaaaatgtaaatcttgtccagaatcggaagctaaaatt
aaaaacgtgataatcttggttccagatgggtgttttcagagtgtccagactcttgccaga
tggtacagtggaagtcctctaatgcttgatgaaatggtcgcaggaacggtctctacttac
agtacagactcagttattactgattcttcatcagctgcaagtgcttttgctaccggatac
aagacaaccaacggctttgtaagtgtcggaccgagcaatgcttcagttttaagtatactg
gaaaacccttctgaagatatgcaatacagaccgcttgcaacagtgcttgaagggtcaaag
cttgaaggcaaggctacagggcttgtagcaacttcccgggtcacccatgctacacctgca
gcttttgcttctcacgtggataacagggataacgaaaacgagatcatggaacagatggtc
tatgaaaatgttgatgtggttttcggaggaggttcccgccatctagtgcctgaagaagaa
ggtggaaaaaggacagatagagaaaacctgacagaagtgcttcttgataggggttaccag
tatgttgacagcagagatgaaatgttgaatctgtcatccggaaaagcatggggccttttt
gccagcagtcacatggcaccggatattgatcgtaccgaacttgtacctgaagaaccctct
ctttcagaaatgaccggaaaagccctagaactgctttcacaggacaaagatggctttttc
cttctggtggaaggtagccaggtagactgggcaaatcacgctaatgaccctgtttatgct
gttacggacttcctggcttttgatgaagctgttaaggttgcagttgaatttgcagaacaa
gatggacatacccttgtcctcgctttccctgaccacaatacaggcgggatgaccattggt
agtgattctgattctaattatacttctacaaccatagaagatgtcattgatcctctcaaa
agcatgaagctcagctctgcaggtattgcggaaaaaataggaacagatgtttcctccgaa
aatattaagactcagctaaaaacctggtggggaattgatgctactgatgatgaagtaact
gaaattcttgaaatctataacaatggagagggcctttccctcgattatgcaatcagcgaa
gtaatcgatcaaaatcatactgttatcgggtggactactcatggacattgtggtgaagat
gtccctctctgggcttatggtcctgaccaccccgcaggtcacctggataacacagaaatt
gcaggatatatcgctgaaaaagccggtttcaacctggaggaaacaaataggtacctgttt
gttgaagtgagtgaggtattctccagagacaacggagacgggaaactggatgaaaatgaa
tatctgctggacctgacaagctccttaaaccctgtgctgaggataggagatgccgaacta
ccggtaagcacaaatattctcatcaaacaaggcgtaacttatgagctcgaaggaatagtc
gtttatgctccggcgacaggtaaagtttacatcccttccgaagtgctttcactggtcaat
gggaaaaagtaa

DBGET integrated database retrieval system