KEGG   Methanosarcina mazei Go1: MM_0673Help
Entry
MM_0673           CDS       T00082                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mma  Methanosarcina mazei Go1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mma00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808943..810028)
Genome map
AA seq 361 aa AA seqDB search
MEKNTEKGEKLEEIRSLLEKFTNAHGISGFEGEVRKLLEKELEPYVDSMREDIMGNLIAV
KEGKGPSVMLAAHMDEIGLMVRYIDENGFLRFVGIGGWFDQTLLNQRVIVHGKKGSIYGV
IGSKPPHVMKDEDRKKPVKLEDMFIDIGAKDREDAENLGVEIGTSVSIDQEFTTLANGKV
TSKAFDNRAGVVILVRVMKELHERGIEANVYAVGTVQEEVGLKGAKTCTFCICPDVALAL
DTTIPGDHPGISKIDSALELGKGPVITVADASGRGLIAHPQILKWLRETADKNEVPYQLG
VGSGGTTDATSIHLTKEGIPTGTVSIATRYIHSPVEVLDMADIDACVSLIVTAIENLKAY
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatacggaaaaaggcgaaaagcttgaagaaataagatcccttctcgaaaag
ttcacgaatgctcacggaatttccggctttgaaggcgaagtccggaaactgcttgagaaa
gagcttgagccctatgttgacagtatgcgggaggacattatggggaacctcatcgctgtt
aaagagggcaaaggtccttctgtaatgctggctgctcatatggatgaaatcgggctgatg
gtcagatatattgatgagaacggtttcctgcgctttgtcgggattgggggatggtttgac
cagactcttctgaaccagagagttatcgtgcatggcaaaaagggctccatttatggagtc
atagggtccaaacctcctcatgtgatgaaagatgaggacagaaaaaagcccgtgaaactc
gaggacatgtttatcgatataggggcaaaggacagggaggacgctgaaaatctgggtgtc
gagataggtacttcagtatcaatcgatcaggaattcacgaccctggcaaacggaaaggtt
acctccaaggcttttgataaccgtgcaggagttgtaattctcgtcagagttatgaaagag
cttcatgaacgcgggattgaagcaaatgtctatgctgtcggcacggttcaggaggaagta
gggcttaaaggagcaaaaacctgtactttctgcatctgcccggatgttgcccttgccctt
gacaccaccatccctggagatcatccgggaatcagcaaaatcgattcagccctggaactt
ggaaaaggaccggtgataactgtagcagacgcgtccggaagaggtctcatagcccatccg
cagattctcaaatggctccgggaaaccgccgataaaaatgaggtcccctatcagctgggt
gtaggttctggaggcaccacagacgctacatcaatccacctcaccaaagaaggtatccct
acaggtacggtcagtatagccacacgctacattcactctcctgtagaggttctggatatg
gctgatatagacgcctgcgtttctctcattgtgacggcaatagaaaatttaaaagcatac
ttctaa

DBGET integrated database retrieval system