KEGG   Methanosarcina mazei Go1: MM_0698Help
Entry
MM_0698           CDS       T00082                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Organism
mma  Methanosarcina mazei Go1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838235..839716
Genome map
AA seq 493 aa AA seqDB search
MEILIATGRLAENTVRKAAGEKADVLVADIDIAAFITPKKLTRAFEEAGLSKKYDLILLP
GLVPGDFSKVSDELDCKIRLGPKHAYDLGFVLRFAEEVEFSVKVPACELLADVRKEEALE
LIREAEEEAVSPLSLRGVKLGGNSRMKVMGEIVGAAELNPADLEIKIEAFIARGADIIDL
GATLNTLPGQVRSTVFLAKSLTDIPISIDTLDPELIKEGIEAGADLVLSLNSTNMETAGS
VVAKAGVAAVIIPDEGNSLESLVNNIESARRLGIERIIADPILDPVGHNITESIVRYHEF
HRRYPDIPLFFGAGNVTELMDVDTIGVNATLCGIGAETGASILFTPEYSDKAQGSIGELK
KASEMMQLCRIRESSPKDLGIDLLFIKEKRKRPDSPLPKKVITARASKNWRQDPAGPIRV
RIVPDKINGNGGLIVAEHEKAAIAGESAREVMDTLIELELVSSLDHAAYLGRELEKAELA
LRFNRSYAQDDIF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttgattgcaacagggcggcttgcggaaaataccgtgagaaaagcggctgga
gaaaaagcagacgtccttgtagcagatatcgacattgctgcctttatcaccccgaaaaaa
cttaccagagcctttgaggaagccggattatcaaaaaaatatgacctcattctgcttccc
ggacttgtaccgggtgatttttcaaaggtatcggacgagcttgactgtaaaatccggctg
ggccctaaacatgcttatgaccttggctttgtgctccgttttgcagaagaagtggagttt
tccgtaaaggtccctgcctgtgagctccttgcagacgtaagaaaggaagaagctcttgag
cttataagagaagccgaagaagaagccgtttctccacttagcctgagaggagtaaaactg
ggaggaaactcccgaatgaaagttatgggagagattgtaggagcagccgagttgaaccct
gctgacctggagataaaaatcgaagcttttatcgcccgtggagcagatattatcgacctc
ggagctacacttaacacccttccgggacaggtccgaagtacggtattccttgcaaaatct
ctcacagatattccgataagtatagatacccttgaccctgagctgataaaggaaggaata
gaagcaggagcagaccttgttctgagccttaacagcacaaatatggaaacagcaggctcc
gtggttgcaaaagcaggtgttgcagcagtcataattcctgatgaaggaaacagtctggaa
agccttgtaaataatatcgaatccgcacgcaggctcgggattgaaagaattatagccgac
cctatccttgaccctgtaggccataatataacggaatccattgttcgctaccatgagttt
cacaggagatatcctgacattccattattctttggggcaggcaatgtaaccgaactcatg
gacgtggatacgataggagtaaatgccacactctgcggaataggagccgaaaccggggca
agtatcctttttacccccgagtacagcgataaagcccagggctccataggagagctgaaa
aaagcctctgagatgatgcagctttgcaggataagggaaagctcccccaaggatcttggc
attgacctcctcttcataaaggaaaaacgaaaacgccctgacagccccctccccaaaaaa
gtgattactgccagagcttcgaaaaactggcgtcaggaccctgcaggcccaataagagtc
aggattgtgccggataaaattaacggaaatggcggactcattgtagccgaacatgagaaa
gcagcaattgcaggagaaagcgccagggaagttatggatacattgattgaactcgaactg
gtctcgagcctggatcacgctgcatatcttggaagagaactggaaaaagccgaacttgct
ctgcgcttcaaccggagttacgcccaggacgatatattttga

DBGET integrated database retrieval system