KEGG   Methanosarcina mazei Go1: MM_0714Help
Entry
MM_0714           CDS       T00082                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MM_0714
   01230 Biosynthesis of amino acids
    MM_0714
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_0714
   00030 Pentose phosphate pathway
    MM_0714
   00051 Fructose and mannose metabolism
    MM_0714
  Energy metabolism
   00680 Methane metabolism
    MM_0714
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MM_0714
Enzymes [BR:mma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MM_0714
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MM_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860242..861171
Genome map
AA seq 309 aa AA seqDB search
MNMAPIKKEDVTVPLDVPKAMRETYIKNYMEITKESGKLMLFAGDQKVEHLNDDFFGPEV
PEDDADPEHLFRIAAQSKIGVFATQLGLIARYGMDYKDIPYLVKVNSKTNLVETEQADPF
SNLWYDIDQVAEFRENSGLNILGVGYTIYLGSEFEAEMLVQAAQVVYDAHQHGMLSVLWI
YPRGAAVKDEKDPHLIAGATGVGACLGSDFVKVNYPKKEGEKSAEIFKEAVKAAGRTKVV
CAGGSSDEAEAFLKKLHDQIHISGAQGNATGRNIHQKPLDEAVRMCNAVYAITVEDASVE
DALRIYSGE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggctccaattaaaaaagaagacgtaaccgtacctttagatgtcccgaaagca
atgcgcgaaacttacataaaaaactacatggaaataacaaaagagagcggaaagctgatg
ctttttgcaggggaccagaaagtagaacacctgaacgatgacttttttggaccggaagtc
cctgaagatgacgctgaccctgaacaccttttcaggattgcagctcagtcaaaaataggg
gttttcgctacccagctagggcttattgcccgctacggcatggactataaggatattccc
tatcttgtaaaggtaaactccaagaccaatctggttgaaaccgaacaggctgaccctttc
agcaacctctggtatgatattgaccaggtagccgagtttagggagaacagcgggctcaac
atccttggtgtcggctatacaatctaccttgggagcgaatttgaagccgagatgcttgtt
caggctgcccaggtagtttatgatgcccaccagcacgggatgctgtccgtactctggatc
tatccgcgtggagctgccgtaaaagatgaaaaggacccgcacctgattgcaggagcaact
ggagtaggagcctgccttgggtcggactttgtaaaggttaattatcccaagaaggaagga
gaaaagtctgccgagatcttcaaggaagcagtcaaagcagccgggcgtacgaaagtagtt
tgcgccggagggtcaagcgacgaagcagaagctttcctcaaaaaactccacgaccagata
cacatctccggagcccaggggaatgcaaccggtagaaatatccaccagaagcccctggat
gaagctgtccgcatgtgcaatgctgtttatgccataactgtcgaagatgcaagcgttgaa
gatgccctcaggatttacagtggagaataa

DBGET integrated database retrieval system