KEGG   Methanosarcina mazei Go1: MM_0749Help
Entry
MM_0749           CDS       T00082                                 

Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mma  Methanosarcina mazei Go1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mma01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mma00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mma00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897990..899330)
Genome map
AA seq 446 aa AA seqDB search
MKAVVYRGPNQVSVEEVEDPKIEHPADAIIRLTSSGICGSDLHMYEGRTVEKPGKVLGHE
PLGVIEEVGDAVTSFKKGDRVVVTFNIACGHCLNCIRGFTSACLTVNPESAGGAFGYAKM
GPYRGAQAEFLRVPFADLNCTKLPGSPGDKWEDDFIMLSDVFPTGFFATQLAMVMPGFPV
AVFGAGPVGLLSAYSAILQGAAQVFVVDYIPERLKLAKSIGAIPVDFTLSDPVAMIEALR
SQHSRVDTVLPGEEKLQGIMSSIENLAKSIGANLELARSDPVTMIQMLRAGNPAIVQSLI
PGEEKMKGVMSGIDAVGYQARDRQDPSRENPTQVISDLVRLINPTGHLGVIGVYVADDPG
AYNERAKKGEYILPFGQLWEKGISVGTGQTPVKKLQPMLRDMIIAGVAKPSFIVSHKISI
EEAPDAYREFAKRSEGFTKVTIQFEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttgtttataggggaccgaatcaggtttctgtagaagaagtcgaagatccg
aaaatagagcacccggcagatgccataatcaggcttacttcgagtggcatatgcggaagc
gaccttcatatgtatgaaggaagaactgttgaaaagccgggaaaagttcttgggcatgag
cctctaggggttatagaagaggtgggggatgccgtgacctcttttaagaaaggggacagg
gttgtcgttacttttaacattgcctgcgggcactgtttgaactgtattcggggttttacc
agcgcctgcctgactgttaatcccgaaagtgcaggaggagcttttggatatgccaaaatg
ggtccttatagaggggctcaggctgaatttttaagggtgccgtttgccgacctgaactgt
acgaaacttccagggtctccaggggataaatgggaagacgatttcattatgctgtcggat
gtatttcctacaggtttttttgctacgcagcttgcaatggtaatgccaggatttcctgtc
gcggttttcggggcaggacctgtaggtttgctctcagcttattccgcaatattgcagggg
gcagctcaggtttttgtcgttgattacattcctgagaggctgaagctggcaaagagtatt
ggtgctattcctgtagattttacacttagcgaccccgtagccatgattgaggcattaagg
tctcagcattcgagagtggataccgtgcttccgggcgaggaaaaactgcagggaatcatg
tccagtatagaaaaccttgccaagagtataggtgctaaccttgaactcgccaggagcgat
cccgtaactatgattcagatgttgagggcaggaaaccctgcaattgttcagtccctgatt
ccaggtgaggaaaaaatgaaaggtgtgatgtccggtatagacgcagtcggatatcaggca
agagacaggcaagatccctcaagggaaaacccaacgcaggtgataagtgatctggtgagg
cttatcaacccgaccggtcacctgggagttatcggggtctacgtggcagatgaccccgga
gcttataatgaacgcgctaagaaaggggagtatatcctgccttttggacagctctgggaa
aaaggtataagtgtaggaacaggccagactccggttaagaaacttcaaccgatgctcagg
gatatgataattgcaggcgtggcaaagccaagctttatagtaagtcacaaaatctccata
gaggaagcgcctgatgcctacagggagtttgccaaacgctcagaaggctttacaaaggta
acaattcagtttgaaaaataa

DBGET integrated database retrieval system