KEGG   Methanosarcina mazei Go1: MM_0818Help
Entry
MM_0818           CDS       T00082                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00330  Arginine and proline metabolism
mma00332  Carbapenem biosynthesis
mma01100  Metabolic pathways
mma01130  Biosynthesis of antibiotics
mma01230  Biosynthesis of amino acids
Module
mma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MM_0818
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MM_0818
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MM_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAM30514
UniProt: Q8PYP3
Position
complement(968646..969803)
Genome map
AA seq 385 aa AA seqDB search
MTEREQFFRDVNKIVIKIGTSSITRKGCDHTRENCNIDPAFMESIAFQVSELRKQGKEVI
IVSSGAIGVGLNELGIAPKPREIPIRQAAAAVGQSMLMQDWSRAFSRYGMKVAQILLTYE
FYSDRVTYLNLRNSISTLLEYGVVPIINENDCTCTNEIEAIFGDNDKLSAMVASKIDADL
LIILSDIDGLFDRNPKTHIDAKLLTIVKKITPEIESYGGDPTSFKGVGGMRTKIKAAKIC
SMAGCYVVIANSDVEDVILKIASGEEIGTLFLAERHIQKNRARWIILARASGTVRVDAGA
KAAVLGKNSLLPAGVVDVEGTFDRGDVVKLECDGKIFAKGITDYTSEELIKIKGVHTDQI
ENVLGYSNYNNVIKKENIGILEELN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaaagagaacaatttttccgtgatgttaataaaatcgtcattaagatcggaact
tcttcaattaccagaaagggctgtgaccataccagggaaaactgcaacattgacccggca
tttatggaaagcatagccttccaggtctcagagctccgaaagcaggggaaagaagtaatt
attgtgagttcgggagcaataggtgtcgggctgaatgagctgggcatagcccccaaaccc
cgtgagatccctatcagacaggcagctgcagcggtcgggcagagtatgctgatgcaggac
tggagcagagctttttccagatacggaatgaaggttgcccagatccttcttacctatgaa
ttctattctgatagagtaacttacctcaacctgagaaacagcatctcaaccctgctggag
tatggtgttgtcccgataataaacgaaaacgactgtacctgtacaaacgagattgaagca
atcttcggggacaatgacaagctctctgcaatggttgcgagcaaaatcgatgctgatctt
ctgattatcctttcggatattgatgggctttttgacaggaacccgaaaactcacattgac
gcaaagcttctgaccattgtgaaaaagatcacgcctgagattgaaagttatgggggcgac
cctacaagcttcaaaggcgttggcgggatgcggaccaaaataaaagctgcaaaaatctgc
agtatggcaggctgctatgtagttattgcaaacagcgatgtagaggacgtcatcctgaaa
atagcctcaggggaagaaatagggacccttttccttgctgaacggcatatccagaaaaac
cgcgctcgctggattatccttgccagggcttcaggaacggtccgtgtagatgccggagca
aaagctgctgtcctcgggaaaaatagccttctcccggcaggcgttgtggatgtggaaggg
acatttgataggggagatgtcgtgaaactcgaatgtgacggcaaaatatttgcaaaaggg
attaccgactatacctctgaagagttaattaaaataaaaggagttcatacagaccagatt
gaaaacgttctgggctacagtaattacaacaacgtgataaaaaaggaaaatatcggcata
ctggaagagttaaattga

DBGET integrated database retrieval system