KEGG   Methanosarcina mazei Go1: MM_0818Help
Entry
MM_0818           CDS       T00082                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mma01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(968646..969803)
Genome map
AA seq 385 aa AA seqDB search
MTEREQFFRDVNKIVIKIGTSSITRKGCDHTRENCNIDPAFMESIAFQVSELRKQGKEVI
IVSSGAIGVGLNELGIAPKPREIPIRQAAAAVGQSMLMQDWSRAFSRYGMKVAQILLTYE
FYSDRVTYLNLRNSISTLLEYGVVPIINENDCTCTNEIEAIFGDNDKLSAMVASKIDADL
LIILSDIDGLFDRNPKTHIDAKLLTIVKKITPEIESYGGDPTSFKGVGGMRTKIKAAKIC
SMAGCYVVIANSDVEDVILKIASGEEIGTLFLAERHIQKNRARWIILARASGTVRVDAGA
KAAVLGKNSLLPAGVVDVEGTFDRGDVVKLECDGKIFAKGITDYTSEELIKIKGVHTDQI
ENVLGYSNYNNVIKKENIGILEELN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaaagagaacaatttttccgtgatgttaataaaatcgtcattaagatcggaact
tcttcaattaccagaaagggctgtgaccataccagggaaaactgcaacattgacccggca
tttatggaaagcatagccttccaggtctcagagctccgaaagcaggggaaagaagtaatt
attgtgagttcgggagcaataggtgtcgggctgaatgagctgggcatagcccccaaaccc
cgtgagatccctatcagacaggcagctgcagcggtcgggcagagtatgctgatgcaggac
tggagcagagctttttccagatacggaatgaaggttgcccagatccttcttacctatgaa
ttctattctgatagagtaacttacctcaacctgagaaacagcatctcaaccctgctggag
tatggtgttgtcccgataataaacgaaaacgactgtacctgtacaaacgagattgaagca
atcttcggggacaatgacaagctctctgcaatggttgcgagcaaaatcgatgctgatctt
ctgattatcctttcggatattgatgggctttttgacaggaacccgaaaactcacattgac
gcaaagcttctgaccattgtgaaaaagatcacgcctgagattgaaagttatgggggcgac
cctacaagcttcaaaggcgttggcgggatgcggaccaaaataaaagctgcaaaaatctgc
agtatggcaggctgctatgtagttattgcaaacagcgatgtagaggacgtcatcctgaaa
atagcctcaggggaagaaatagggacccttttccttgctgaacggcatatccagaaaaac
cgcgctcgctggattatccttgccagggcttcaggaacggtccgtgtagatgccggagca
aaagctgctgtcctcgggaaaaatagccttctcccggcaggcgttgtggatgtggaaggg
acatttgataggggagatgtcgtgaaactcgaatgtgacggcaaaatatttgcaaaaggg
attaccgactatacctctgaagagttaattaaaataaaaggagttcatacagaccagatt
gaaaacgttctgggctacagtaattacaacaacgtgataaaaaaggaaaatatcggcata
ctggaagagttaaattga

DBGET integrated database retrieval system