KEGG   Methanosarcina mazei Go1: MM_0921Help
Entry
MM_0921           CDS       T00082                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MM_0921
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MM_0921
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MM_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087157..1088890
Genome map
AA seq 577 aa AA seqDB search
MKRDFDMVYRTGKTVYIDLGSESVNAVETDEKLVLNYLGGRGLGVKLLSELADADIDPLS
PLNPLIFTAGLITGLAPMSSGAVVTSKSPLTGTVFSWNTGGGFGRELKTAGIDALVITGK
AKRPSLVEVKGEKIKVRQADHLWGKNTGACTEALKNKGSAACIGRAGEKGALISSFVIDS
IHSGRGGLGAVAGSKMLKAVIVKGEKEILPASPESFGDLRAKMLKLFEANPVLSKGLSNY
GTPAFVKLLDYMDLIPGRNFSERRTSFADRFSGEYIKASFNLEKESCPSCPLSCKRRIKK
TGQILPDYDSLWAFGFNLENPDFNSVLLADRICKDYGLDPVSAGSVLGALAELKSEKIEA
RELEGLLEEMGEGGKAGEGARKYLSSRGREDISMDVKGLELAGFDPRGIKGQALAYATSC
HGGDYLTAFMVGPEVLGKPLMLDRFSLKGKAGILQAFENMTAVLDSLVLCPFSVFAVGEE
LCSALLYAGTGIKISPAELLKAGERIWNLERVYNIKAGFSREDDTLPQRLFETSEWKGIG
IDKQEFNAALREYYHYRGWDREGVPLQEKLEELEIAY
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagggattttgatatggtttaccggacaggaaaaacagtatatatagaccttggc
tcggaatcggttaatgctgtagagactgatgaaaagttagtcctcaattaccttgggggg
agagggctcggagtaaaactgctttccgaactggcagatgctgatattgatcccctcagc
ccgttaaatccacttattttcactgcagggctgatcacgggacttgctcccatgtcttca
ggtgcagttgttacatcgaaatcccccctcacaggcacggtattcagctggaacacaggc
ggaggctttggaagggaactgaaaacagctggaattgatgcgcttgtcattaccggaaaa
gcaaagaggccttctcttgtggaggtaaagggcgagaagataaaagtcaggcaggcagac
catttatggggtaaaaatacgggagcatgtaccgaagccctgaaaaataaaggaagcgca
gcctgtataggcagggcaggagaaaagggagcccttatttcttcttttgtaattgattcc
attcacagcggccggggaggcctgggagctgttgcaggctcaaagatgttgaaagcggtg
attgtaaagggtgaaaaagagatcctgcctgccagccctgagagttttggggatctcagg
gcaaaaatgttgaagctttttgaagcaaaccctgtactttccaaagggctttcaaattac
ggcactcctgcatttgtcaagctgctggactatatggacctcatcccgggaagaaacttt
tccgaaagaaggacttcttttgctgaccgtttctcaggtgagtatataaaagccagtttt
aatctcgaaaaagaaagctgcccctcctgccccctgagctgtaaacggagaataaaaaaa
acagggcaaattcttcctgactacgattctttatgggctttcggatttaaccttgaaaac
cccgactttaactccgtgctcctggcagacagaatatgcaaagactacgggcttgaccct
gtttctgcgggttcggtacttggcgctctggcagaactcaaatcagaaaaaatagaggca
agagaacttgaaggtctgcttgaagaaatgggagaaggaggcaaagccggggaaggtgcc
agaaaatatctctcaagccgggggagagaagatatcagcatggatgtaaaagggcttgaa
ctcgcagggtttgaccccagggggattaaaggtcaggctctggcttacgcgacttcctgc
cacggcggagattatcttacagcctttatggtagggccggaagttctaggaaaaccactg
atgctggaccgcttcagccttaaaggaaaagccggaatcctgcaggcatttgaaaacatg
actgctgtgcttgattctcttgtactctgcccgttctcggtttttgccgtaggcgaagaa
ctctgttcagctttattatacgccgggacaggaataaaaatatctcctgcagaactcctg
aaggctggggaaaggatctggaatcttgaaagagtttacaatataaaagcaggattctct
cgagaagatgatacactcccgcaaaggctgttcgaaacgagtgaatggaaaggaattgga
atagataagcaggagtttaacgcagctctccgggagtattatcattacaggggctgggac
agagaaggcgtgcctctccaggaaaagcttgaagaactggaaatcgcatactga

  All links  
No link information was found.   
DBGET integrated database retrieval system