KEGG   Methanosarcina mazei Go1: MM_0923Help
Entry
MM_0923           CDS       T00082                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MM_0923
Enzymes [BR:mma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MM_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089822..1090697
Genome map
AA seq 291 aa AA seqDB search
MFLPNSFIDALADYESARYVIFGVPFDNTSSYRAGSRWAPDAMRQVSANFESYNPVFDID
LVDLPIYDAGNLETSASVDETLRDLYEEVKALLNNGKLPIMLGGEHSLTYSTVKACAEFA
GDDFGVLILDAHFDLREEYRGFKHNHACVSRNILENITDNLVSIGIRSGPEEEWIFAREN
KLKYYTADDVESIGMVEVLKEAIESLDCSQLYLSLDMDAIDPAYAPGLGTPEPFGLSARD
VRTAIRTLAPYSMAFDVVEIAPEYDSGQTAMLGAKLMREFIASHAKSCIKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacccaattcctttatagatgccctcgcagactacgaatctgcacgctacgta
atttttggcgtaccctttgataatacctcttcataccgtgcaggcagccgctgggctccg
gatgctatgaggcaggtttctgcaaattttgagagttataacccggttttcgacatagac
cttgtagaccttccgatatatgatgcaggaaacctggaaacttcagcctcggttgacgag
accctgagagacctttacgaagaggtaaaggctctgctgaacaacggaaagcttcctatt
atgcttgggggcgagcactccctgacttattctacggtcaaagcctgtgcggaattcgca
ggggatgatttcggagtccttattcttgatgcccactttgacctcagggaggagtacaga
gggttcaaacacaaccatgcatgtgtatcccggaatattctggaaaatatcacggataat
ctcgtttctataggtataaggagcgggcccgaagaagaatggatttttgccagagaaaat
aagctgaaatactacacggcagatgatgttgaatccataggcatggtagaagtcctcaaa
gaagcgattgaatcgcttgactgcagccagctctacctttcccttgatatggatgcaata
gatcccgcgtatgcccccggactgggaacacctgaacctttcgggctgagtgccagggat
gtcaggactgcgataaggacccttgccccttactcaatggctttcgatgttgttgaaatt
gcccctgaatacgactccggacagacagcgatgctcggagcaaaacttatgagagaattt
attgcctctcatgcaaaaagctgcatcaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system