KEGG   Methanosarcina mazei Go1: MM_0923Help
Entry
MM_0923           CDS       T00082                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089822..1090697
Genome map
AA seq 291 aa AA seqDB search
MFLPNSFIDALADYESARYVIFGVPFDNTSSYRAGSRWAPDAMRQVSANFESYNPVFDID
LVDLPIYDAGNLETSASVDETLRDLYEEVKALLNNGKLPIMLGGEHSLTYSTVKACAEFA
GDDFGVLILDAHFDLREEYRGFKHNHACVSRNILENITDNLVSIGIRSGPEEEWIFAREN
KLKYYTADDVESIGMVEVLKEAIESLDCSQLYLSLDMDAIDPAYAPGLGTPEPFGLSARD
VRTAIRTLAPYSMAFDVVEIAPEYDSGQTAMLGAKLMREFIASHAKSCIKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacccaattcctttatagatgccctcgcagactacgaatctgcacgctacgta
atttttggcgtaccctttgataatacctcttcataccgtgcaggcagccgctgggctccg
gatgctatgaggcaggtttctgcaaattttgagagttataacccggttttcgacatagac
cttgtagaccttccgatatatgatgcaggaaacctggaaacttcagcctcggttgacgag
accctgagagacctttacgaagaggtaaaggctctgctgaacaacggaaagcttcctatt
atgcttgggggcgagcactccctgacttattctacggtcaaagcctgtgcggaattcgca
ggggatgatttcggagtccttattcttgatgcccactttgacctcagggaggagtacaga
gggttcaaacacaaccatgcatgtgtatcccggaatattctggaaaatatcacggataat
ctcgtttctataggtataaggagcgggcccgaagaagaatggatttttgccagagaaaat
aagctgaaatactacacggcagatgatgttgaatccataggcatggtagaagtcctcaaa
gaagcgattgaatcgcttgactgcagccagctctacctttcccttgatatggatgcaata
gatcccgcgtatgcccccggactgggaacacctgaacctttcgggctgagtgccagggat
gtcaggactgcgataaggacccttgccccttactcaatggctttcgatgttgttgaaatt
gcccctgaatacgactccggacagacagcgatgctcggagcaaaacttatgagagaattt
attgcctctcatgcaaaaagctgcatcaaaaaataa

DBGET integrated database retrieval system