KEGG   Methanosarcina mazei Go1: MM_1133Help
Entry
MM_1133           CDS       T00082                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MM_1133
   00052 Galactose metabolism
    MM_1133
   00500 Starch and sucrose metabolism
    MM_1133
   00520 Amino sugar and nucleotide sugar metabolism
    MM_1133
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MM_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1336385..1337356)
Genome map
AA seq 323 aa AA seqDB search
MGEKYFNSEEYNLTEFLFIGELTLTIKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVI
QYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKHQTDMLKLVRDISSLVD
IHYIRQKEPNGLGDAVLRAENHIGDEPFAVLLGDDIIVNDKPCTAQLIENFEKYGRSTIA
VEEVPYEKLSSYGIIKGKPLDDSLYVLEDIVEKPAPEDAPSNIGAIGRYVFTPEIFDCIK
HAGTGVGSEIQLTDGIRLLNKSQMIYACRFKGKRFDTGDRLGYVKSIVDFALQNENLRDD
VLEYLREILAVNKISPEIDKLKQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaagtactttaactcagaagaatacaaccttacagaatttcttttcattgga
gaattaaccttgactatcaaaaaagcacttatcccggcagccggtcttgggactcgcttt
ctgccggcaacaaagtcaatgccaaaagaaatgcttcctataattgacacacctgtaatt
cagtatgtagtggaggaagctattgcctcaggcatagaagatattattattattacaggc
aggggcaagagagcaattgaggactacttcgatgattctccggaacttgagatgcatctt
gctaaaaaacaccagacagatatgctgaaactggtccgggacatctcttctcttgtagat
atccactacatccgccagaaagagcccaatgggcttggagatgcggtattaagggcagaa
aaccatatcggagacgagccttttgcggtgcttctcggagacgatattatcgttaacgac
aaaccctgcactgcccagcttattgagaactttgagaaatacgggaggtcaacaatcgca
gttgaagaggtcccttacgaaaaactgagcagttatggaattataaaaggcaagcccctc
gatgattccctttatgttcttgaagacattgtagaaaaaccagcacctgaagatgctcct
tccaatataggagcaatagggcgctatgtattcacgcctgagatttttgactgcataaag
catgccggtactggcgttggaagtgaaatacagctcacagacggtatcaggctccttaac
aaatcccagatgatctatgcctgcagatttaagggaaaaaggttcgatacaggagaccgg
ctcgggtacgtaaaatccatagtcgattttgctctccagaacgaaaacctcagggacgat
gtgcttgaataccttcgggaaattctcgcagttaataagatttctccagaaatagataag
ttaaaacaataa

DBGET integrated database retrieval system