KEGG   Methanosarcina mazei Go1: MM_1213Help
Entry
MM_1213           CDS       T00082                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MM_1213 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MM_1213 (pyrB)
Enzymes [BR:mma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MM_1213 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435214..1436143)
Genome map
AA seq 309 aa AA seqDB search
MMLFKNRHVISMKDFSREEIDYILDIAEKLEPVARGEERSRLLDGKIISLLFFEPSTRTR
LSFEVATRRLGGQVLSLGSVEASSVMKGENLADTIRVISKYADLIVLRHPLDGSARMATE
FAAVPVINGGDGSVHHPTQTFLDLYTIRRESHLEGLKIAMAGDLKYGRTVHSLCYALSLY
GAEMTFVSPPELRMPREIVRELRKKNIRVKESECLEEIIGDIEVLYMTRVQRERFPDPQE
YEKVKNKLKITGDLLKSADPELKILHPLPRVNEISPDVDDTPHARYFEQAFYGVPIRMAL
LALTIGVIE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgatgttattcaagaaccggcacgtcatctccatgaaagatttttcacgggaagaaatc
gattatattctggacattgcagaaaaactcgaacctgtagccaggggggaagaaaggtcc
aggcttcttgacggaaaaatcatttctcttcttttttttgaaccaagtacaagaacacga
ctctcttttgaggttgccacccggaggctgggggggcaggtcctgagtctgggttcggtt
gaggcaagttctgttatgaagggggaaaatcttgctgatactatccgcgtgatcagcaaa
tatgcagacctgattgtgctgcgtcaccctcttgacgggtcagcaagaatggctacggaa
tttgcagctgtccctgtgatcaatgggggagatggttctgtccaccatcctacccagact
tttcttgacctctataccatccgccgagaaagccatcttgaaggcttgaaaattgccatg
gcaggagacctgaaatatgggagaacagtacattccctctgctatgccctttccctgtat
ggggcagaaatgacttttgtttcacctccggaactcaggatgccccgggaaattgtccga
gaacttcggaagaaaaatatccgcgtaaaggaaagcgagtgccttgaggaaataatagga
gatattgaagttctttacatgacaagagttcagagggagcgttttcctgaccctcaagaa
tacgaaaaggttaagaataagttaaaaattacgggagatctcttaaaatccgcagatccc
gaacttaaaatccttcaccctcttccaagggtaaatgaaatatctcctgatgttgatgat
actccccatgcccgttattttgagcaggctttttatggagttcctatcaggatggcttta
ctcgctctgacaataggggtgattgaatga

DBGET integrated database retrieval system