KEGG   Methanosarcina mazei Go1: MM_1278Help
Entry
MM_1278           CDS       T00082                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00010  Glycolysis / Gluconeogenesis
mma00051  Fructose and mannose metabolism
mma00562  Inositol phosphate metabolism
mma01100  Metabolic pathways
mma01110  Biosynthesis of secondary metabolites
mma01120  Microbial metabolism in diverse environments
mma01130  Biosynthesis of antibiotics
mma01200  Carbon metabolism
mma01230  Biosynthesis of amino acids
Module
mma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mma_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_1278
   00051 Fructose and mannose metabolism
    MM_1278
   00562 Inositol phosphate metabolism
    MM_1278
Enzymes [BR:mma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MM_1278
Exosome [BR:mma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MM_1278
  Exosomal proteins of bladder cancer cells
   MM_1278
  Exosomal proteins of melanoma cells
   MM_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: AAM30974
UniProt: Q8PXE2
Position
complement(1513886..1514554)
Genome map
AA seq 222 aa AA seqDB search
MGSPFILLNYKTYIQGTGKGAVDIAKACKTVSEESGIEIAVAPQLPDIYRVASEVELSVF
SQHMDGIGAGSFTGHVFGKCIKEAGAFGTLINHSERRLTLAEIEASLKAAKEFGLRAIIC
TNNVPTTAAAAALVPDYVAIEPPELIGSGIPVSKADPEVVSGSVEAVSKINPDVKVLCGA
GISKGEDLRAALDLGSQGVLLASGIVKASDPKAALEDLIRLV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggttcaccattcattttactgaactataagacttatatacagggcacaggcaagggc
gcagttgatattgcaaaagcctgcaaaaccgtatccgaagagtcaggtatcgagattgca
gtagctcctcagcttccggatatttacagggtagcttccgaagttgaactttcggttttt
tcccagcacatggacggcataggagcaggaagttttacaggtcatgttttcggaaaatgt
ataaaagaagcaggagctttcgggactcttatcaaccactctgaaaggcgtctgaccctt
gcggaaatcgaagcttcgttgaaagctgcaaaagagttcgggctcagggcaattatatgc
accaacaacgtccccacaactgcagcagctgcagcgcttgttcctgattacgtagcaatc
gagccacctgagcttataggtagcggaattcctgtctcaaaagccgaccctgaagttgtc
agtggttctgttgaagcggtttcaaagatcaatcctgatgtaaaagtgctttgtggagcc
ggaatttcaaaaggtgaagacctgagggcagcccttgaccttggctcgcagggagtacta
ctcgcatccggtatagtgaaagcttcagatcctaaagctgcacttgaagaccttattcgg
cttgtttaa

DBGET integrated database retrieval system