KEGG   Methanosarcina mazei Go1: MM_1341Help
Entry
MM_1341           CDS       T00082                                 

Definition
(GenBank) pyruvate synthase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00010  Glycolysis / Gluconeogenesis
mma00020  Citrate cycle (TCA cycle)
mma00620  Pyruvate metabolism
mma00633  Nitrotoluene degradation
mma00640  Propanoate metabolism
mma00650  Butanoate metabolism
mma00680  Methane metabolism
mma00720  Carbon fixation pathways in prokaryotes
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
mma01130  Biosynthesis of antibiotics
mma01200  Carbon metabolism
Module
mma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_1341
   00020 Citrate cycle (TCA cycle)
    MM_1341
   00620 Pyruvate metabolism
    MM_1341
   00640 Propanoate metabolism
    MM_1341
   00650 Butanoate metabolism
    MM_1341
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MM_1341
   00680 Methane metabolism
    MM_1341
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MM_1341
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MM_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_2 Fer4_9 Fer4_21 Fer4_7 Fer4_10 Fer4_16 Fer4_4 Fer4_13 Fer4_8 Fer4_17 Fer4_15 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AAM31037
UniProt: Q8PX81
Position
complement(1605266..1605598)
Genome map
AA seq 110 aa AA seqDB search
MSSKTEQDRKIRPEVLKTDLEKNGLNISRCRTCKPGSTLKNKTGGWRNFRPVYIYEKCTK
CGICEMVCPDMSVKPREDGFFEYDYDYCKGCGVCANECPADAIEMVLEEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaaaacagaacaggaccgcaaaattcgtccagaagtgctaaaaacagatctg
gaaaaaaacggtttaaatatttcgcgctgcagaacatgcaaacccggttcaacacttaaa
aacaaaaccggtggctggagaaacttccgtcccgtatatatttacgaaaaatgtaccaag
tgcggaatctgtgagatggtgtgccctgacatgtctgtaaagcctagagaagatggcttt
tttgaatatgattatgattactgtaaaggttgcggcgtctgtgcaaatgagtgccctgca
gacgcaattgaaatggttctggaggagaaataa

DBGET integrated database retrieval system