KEGG   Methanosarcina mazei Go1: MM_1341Help
Entry
MM_1341           CDS       T00082                                 

Definition
pyruvate synthase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MM_1341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_1341
   00020 Citrate cycle (TCA cycle)
    MM_1341
   00620 Pyruvate metabolism
    MM_1341
   00640 Propanoate metabolism
    MM_1341
   00650 Butanoate metabolism
    MM_1341
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MM_1341
   00680 Methane metabolism
    MM_1341
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MM_1341
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MM_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1605266..1605598)
Genome map
AA seq 110 aa AA seqDB search
MSSKTEQDRKIRPEVLKTDLEKNGLNISRCRTCKPGSTLKNKTGGWRNFRPVYIYEKCTK
CGICEMVCPDMSVKPREDGFFEYDYDYCKGCGVCANECPADAIEMVLEEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaaaacagaacaggaccgcaaaattcgtccagaagtgctaaaaacagatctg
gaaaaaaacggtttaaatatttcgcgctgcagaacatgcaaacccggttcaacacttaaa
aacaaaaccggtggctggagaaacttccgtcccgtatatatttacgaaaaatgtaccaag
tgcggaatctgtgagatggtgtgccctgacatgtctgtaaagcctagagaagatggcttt
tttgaatatgattatgattactgtaaaggttgcggcgtctgtgcaaatgagtgccctgca
gacgcaattgaaatggttctggaggagaaataa

DBGET integrated database retrieval system