KEGG   Methanosarcina mazei Go1: MM_1351Help
Entry
MM_1351           CDS       T00082                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mma  Methanosarcina mazei Go1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618472..1620208)
Genome map
AA seq 578 aa AA seqDB search
MKTEIKLLNEYYPWQEIKLKGARCYLKGNVFLENEFLSTERLAELISSLICKEEQEKETR
NFLKKLNGVFALVAETKDIIFCVVDKTRSTPLFYVKTKNSFIVSDSAHYLKDKINPHLNE
ENAAEFMVAGYVTGNETLFDDIKQVRNAEFLIYQKNDGLLKSCCYFKFLHGNYYELPENA
LLEIFDRTLVNAFSRLVKSTSQQGKTLVVPLSGGLDSRIIVAMLKRLGANDVICVSYGRK
GCRESEISKNVAEALGYEWIFVESTAKKWRENYNSKEADLFRIWAANLTSLPHMQDFPTV
KELKLQGKIPENSVFVPGHTGYGTYIPDSASFDLEAYLEASLKKHYNLWPYGQEPEKVFK
QRVSKLISGLEIKDNETFANALEYFDSNERQAKFILNSVRVYEFFGYEWRIPLCDSELIE
FFLRVPIEYRINCNLYKKYARNCLFSGELEMLQKIDCTTDFLNLKALKKRSIYEKVLHYR
TFAHSYYDQKVNNPVWGRYFENPLISRLLIKVSRYENENIDDYPLLKSILEYRNEEKYPL
TVNGMSSLEYLSGIKGETYASRSKKVIKPAGSPVKRPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgaaataaaattactgaatgagtattatccctggcaagaaataaaactcaag
ggagccagatgctatctaaaaggaaatgtatttctggagaatgaatttctgagtacggaa
aggcttgctgagttaatatcttcattaatctgtaaagaggaacaggaaaaggaaacgaga
aatttccttaagaaattaaacggggtatttgcacttgttgccgaaactaaagatattatt
ttttgtgttgttgataaaacaagaagcactcctctgttttatgtaaaaacaaaaaatagt
tttattgtatcagacagtgcccattatttaaaagataaaattaacccgcatctgaatgag
gaaaatgctgcagagtttatggttgcaggttatgtaacaggcaatgagaccttatttgat
gatataaaacaggtaagaaatgcagaatttttaatttatcaaaaaaatgacgggcttctg
aagtcctgttgctacttcaaatttttacacgggaattattacgaactgcctgaaaatgca
ttgcttgagatttttgaccggacacttgtaaatgctttctcaaggcttgtaaaaagcacc
agtcaacagggaaaaacgctggttgttccgctaagcggcgggcttgattctcgcatcatt
gttgcaatgctgaagaggcttggagctaatgatgtcatatgtgtaagttacgggagaaaa
ggttgccgggagtcagaaataagcaaaaatgtggcagaagctctcgggtatgagtggatt
ttcgtagaatctacagcaaaaaaatggcgtgaaaattataattcaaaagaagcggacctg
ttccggatttgggctgcaaacctgacatctctcccgcacatgcaggactttcctactgta
aaagagttaaagctccaggggaaaataccggaaaattcagtattcgttcccggacatacg
ggatacggcacttatattcccgattcagcgagtttcgatttagaagcttacctggaagcc
tctctgaaaaaacattacaacctgtggccatatggacaggagcccgaaaaggtcttcaag
cagagggtaagcaaattaatatcaggacttgaaattaaagacaacgaaacatttgcaaat
gcactcgaatattttgattccaatgaaaggcaggcaaaatttatcctcaattcagtcaga
gtttatgagttttttggatacgaatggaggattccattatgcgactccgaattgattgaa
ttctttttaagggtaccgattgaatacaggataaactgtaacctctacaaaaaatatgcc
agaaactgcctgttttcaggagaactggagatgcttcaaaaaattgactgtaccaccgat
ttcctgaacctcaaggctctgaaaaagagatcaatatatgaaaaggtccttcattacagg
acattcgctcacagttactatgatcaaaaagtgaataaccctgtatggggaaggtacttt
gaaaatcctcttatttcgagacttctaattaaagtttcaagatatgaaaacgaaaatatt
gatgactacccactactaaaatcaatcctggaatacagaaacgaagaaaaatatcctctg
acagtgaatggaatgagttcccttgaatacctttcaggcattaaaggagaaacttatgct
tccaggagcaagaaagttattaagccagctggctctccggtaaaaaggcctctttaa

DBGET integrated database retrieval system