KEGG   Methanosarcina mazei Go1: MM_1421Help
Entry
MM_1421           CDS       T00082                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mma  Methanosarcina mazei Go1
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MM_1421
Enzymes [BR:mma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     MM_1421
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     MM_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1703918..1704682
Genome map
AA seq 254 aa AA seqDB search
MKFEAIAVEKIPLIHEGDNLPSIICEKIGLQDRDIMIIASTIVAKAEGEIFRLEDITPGE
EALEIAARTGKDPRFIQAVLSKSREVFVETPFMLVTTLAGHTCVNAGIDESNIENGFLLY
PPENPDASALKIGKELEKLSGKKLSIIITDTNGRAFKIGQTGVAIGIYNIKPVKRWIGEK
DLFGKVLEITEQAIADELAGAANLLMGEGAGGIPVVIIRGLDYYCEGDTSIKESYRPENM
DVIKQGLRCLRNKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattcgaagcaattgccgtagaaaaaatccctctcatacatgaaggagacaacctg
ccctccatcatctgtgagaaaattggacttcaggacagagacattatgattattgcatca
accattgttgcaaaagccgaaggggaaattttcaggctcgaagatatcacccctggagaa
gaagctcttgaaattgcagcccggacaggaaaagatcctcgttttatacaggcggtcctt
tcaaagagcagggaagtctttgtcgagacaccttttatgcttgtgacgactctcgcaggg
cacacctgtgttaatgcaggaattgacgagtctaatattgagaacgggtttttactgtac
ccccctgaaaacccggatgcaagtgccttaaaaatcggaaaggaacttgaaaagcttagc
gggaaaaagttaagcattattattacggacacaaacggaagagctttcaagatcgggcag
actggagttgccatcggaatttataatataaaacctgtaaaacgctggataggggaaaag
gaccttttcggcaaagtcctggaaatcacagagcaggcaattgctgacgaacttgcaggt
gctgccaatcttttaatgggagaaggagcaggtggaatcccggttgtaatcatccgcggg
cttgattactactgtgaaggggatacatctataaaagagtcataccgccctgaaaacatg
gatgtcattaaacagggtcttcggtgcttgagaaataagaaatga

DBGET integrated database retrieval system