KEGG   Methanosarcina mazei Go1: MM_1521Help
Entry
MM_1521           CDS       T00082                                 

Definition
phosphoglucomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_1521
   00030 Pentose phosphate pathway
    MM_1521
   00051 Fructose and mannose metabolism
    MM_1521
   00052 Galactose metabolism
    MM_1521
   00500 Starch and sucrose metabolism
    MM_1521
   00520 Amino sugar and nucleotide sugar metabolism
    MM_1521
  Nucleotide metabolism
   00230 Purine metabolism
    MM_1521
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MM_1521
Enzymes [BR:mma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MM_1521
    5.4.2.8  phosphomannomutase
     MM_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812789..1814135
Genome map
AA seq 448 aa AA seqDB search
MELFGTNGVRGIANEFITPELAVNVAKSLGTYMGSKGTVAIGCDTRISGQMLKSAAIAGA
LATGLSVIDVGTVPTPSIQYYVRDYADAGIVITASHNPREYNGIKLIAGDGSEFPRDGER
EIEKIYFSGKFSIVSWDKTGSFRFDPSVNDYYIKNIVRAVNVEAIRSRRFKVVVDTGCGA
GSLTLPFLLRELGCEVLTLGAQPDGTFPWRNPEPTPDALTELSALVKKTGAAFGAAHDGD
ADRIVFMDENGEFVNEEVLLAMMTKYMLELEKGPVVTPVSSSQRMADVTKEAGVELYWTA
VGSINVARKMMETGAVFGGEGNGGLIFPKHQYCRDGAMACAKILEILASGKKLSELTESV
PVYFNAKTKTPSRDIVGTMGRIRYETSSMGLKTDTIDGVKIWYDDGWVLIRPSGTEPIFR
IFAEAKKQDRAEELMNQGLETVLRAEKA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaattattcggaaccaatggtgtgcgcggtatcgccaacgaatttataacgcctgaa
ctggcggtcaatgtggctaaaagccttggcacgtacatgggctcaaaaggtacggttgca
ataggctgcgataccaggatttcgggccagatgctgaaatccgcagcaattgccggagct
cttgcaacaggcctgagcgtaattgatgtggggaccgtccctactccttctattcaatac
tacgtgcgcgactatgccgatgccgggatcgttatcactgcatcccacaacccgagggaa
tataatggaattaagctgattgcaggagacggctcggaattcccgagggatggggaaagg
gaaatcgaaaaaatctatttttcaggcaaattctcgattgtttcatgggacaaaaccgga
agtttcagattcgatccgtcggttaatgattattacataaaaaatatcgtacgcgcggtt
aatgtcgaagctatcaggagccggaggtttaaggtagtggttgataccggctgcggggca
ggttcccttacccttcccttcctgctcagggaactggggtgtgaagtccttactctcggg
gcccagcctgacgggactttcccctggagaaacccggagcctactcctgatgccctgaca
gagctctcagctctcgttaaaaagacaggggcagcttttggggcagctcatgacggggac
gcagacagaatagtcttcatggacgagaacggggagttcgtaaatgaggaagtcctgctt
gcaatgatgacgaaatacatgcttgagcttgaaaaagggcctgtggtcactccggtaagc
tcttcccagcgcatggctgatgtcacaaaggaagcaggggttgaactttactggactgct
gtgggttcaataaatgtagccagaaaaatgatggaaacaggcgctgtttttggcggcgag
ggcaatggaggtcttatcttccccaaacatcagtactgccgggacggagctatggcatgt
gcaaaaatccttgaaatccttgccagtggaaagaagctttccgagctaactgaaagcgtg
cctgtatatttcaatgcaaaaaccaagactccttccagggatattgtgggcactatggga
agaatcagatatgagacctcaagcatgggccttaaaacagatactattgacggagtcaag
atctggtacgatgacggatgggtccttatacgcccttcaggtacagagccaattttccgg
atatttgccgaagcgaaaaagcaggacagagcagaggaattaatgaaccagggtttggaa
acggttttaagggcagaaaaagcctga

DBGET integrated database retrieval system