KEGG   Methanosarcina mazei Go1: MM_1535Help
Entry
MM_1535           CDS       T00082                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mma  Methanosarcina mazei Go1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mma00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1833999..1834586
Genome map
AA seq 195 aa AA seqDB search
MALFLYISLKMWQEMAKYGRKLVEHGLVESNFGNISVRAGDRIVITRSGTALDEITGDNI
VEVGIRDTSSLDMIASSEAVVHREIYRRTSVLAIIHAHCPYSVVESLLAGPGNVIVPVDS
EGQYFLGDIPVVGGGIGSSELAKNLADSLSGHRGAVVFSHGTFATGRTLGEAYIVTTQLE
HSCRVKYLYDLAVQK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcactctttctctatatctcgcttaagatgtggcaggaaatggcaaaatacgggcgc
aagctggttgaacatgggcttgtggaatcaaattttggaaatatcagcgtcagggcaggg
gacagaatagtcattacccggagcgggaccgcacttgacgagatcaccggtgataatatt
gttgaggttggcatccgggatacctcgtccctggacatgattgcgtcttccgaagccgtg
gtacacagggagatctacaggaggacttctgtccttgcaataattcatgcacactgccct
tattcggtggttgaatccctgcttgccggtcctggcaatgtaattgttcccgtagacagt
gagggccagtatttccttggagatattccggttgtgggaggaggaatcggaagctcagag
cttgcgaaaaaccttgcagattcgctttccgggcacaggggagctgtagtattcagccac
ggtacctttgccacagggagaacgttaggtgaagcttatattgtgaccacacagcttgag
cactcctgcagagtgaaatacctgtacgaccttgcagtacaaaagtga

DBGET integrated database retrieval system