KEGG   Methanosarcina mazei Go1: MM_1706Help
Entry
MM_1706           CDS       T00082                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mma  Methanosarcina mazei Go1
Brite
Enzymes [BR:mma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MM_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049308..2050039)
Genome map
AA seq 243 aa AA seqDB search
MPERRGIVLVNAVSEKDLGEDKRKREKEKECEKLRKLLVEGLEGFVIDEKVLQAMLRVPR
HRFVPEYEQRAAYVDMPLEIGHGQTISAPHMVAMMCEILELAEGHKVLEIGAGSGYNAAV
MSELVGKTGHIYTVERVEPLANFAKKNLKEAGYKNVTVLLENGSMGYPGYAPYDRIAVTC
AAPNIPETLLEQLKPGGIMVIPVGSYSQELIRVKKDSTGKIYRKKKGDVIFVPMIGKHGF
RRI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaaagaagggggatagttctggtcaacgcagtttcagaaaaggaccttggtgag
gataaaagaaaaagagaaaaagaaaaagaatgtgagaagctccgcaagctccttgtagaa
ggtcttgaaggtttcgtaatagacgaaaaagtgctccaggccatgctccgtgtcccaagg
cacaggtttgttccggaatatgagcaaagggcagcttatgtagacatgcctcttgaaata
ggccatgggcaaacaatatctgccccccacatggttgctatgatgtgtgaaatcctggag
ctggctgaagggcataaagttctggaaattggagcaggttcaggatataatgctgcagtg
atgtcagagcttgtaggaaaaaccgggcatatttacactgtggagcgggtagaacctctt
gcaaattttgcaaagaagaacctgaaagaagcagggtataaaaatgttacagttttactt
gagaatgggtcaatgggttatcccggatatgccccctatgacaggatagctgtaacatgc
gcagctcccaatatccctgaaactctcctggaacaattgaagcccgggggtataatggta
atccctgtggggagctattcccaggagctaatcagggttaaaaaagacagcacaggcaag
atatacaggaagaaaaaaggcgacgttatctttgtgcctatgattggcaaacacggcttt
cgaaggatttga

DBGET integrated database retrieval system