KEGG   Methanosarcina mazei Go1: MM_1742Help
Entry
MM_1742           CDS       T00082                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mma  Methanosarcina mazei Go1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MM_1742
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MM_1742
Exosome [BR:mma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MM_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2083290..2084264
Genome map
AA seq 324 aa AA seqDB search
MFPEIRLRRLRKGKIRDLVRETTLSVDDLVMPIFVNENIDSPVEISSMPGIYNFPLSEVA
KEAKEIADLGIPAVILFGVPAFKDAEGSTSCGENDVVQEAVRRIKAELGNRLVVITDICM
CEFTSHGHCGIVDFETQEVLNDPTLEVLGKIAVSHARAGADMVAPSGMMDGMVGAIRMAL
DASGFENIPIMSYAAKYHSCFYGPFREAAESGYSFGDRSTYQMDPANSDEALREVALDVA
EGADILMVKPGLPYLDIVYRVKSEFGMPTAAYNVSGEYSMIKAAAASGWIDEKKAIYESL
ISIKRAGADFIITYFAKDAARMLK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagaaatcaggttgagaaggttgagaaaagggaagatcagggaccttgtgcgt
gagaccaccttatccgtggacgacctggttatgcccatttttgtgaatgagaatattgat
tcccctgttgagatctcttccatgccgggaatatacaattttcccctttctgaggttgca
aaagaggcaaaagagattgcagacctcgggattccggcagtgatccttttcggagtccct
gcattcaaagatgccgagggcagcacttcctgcggggaaaacgacgtggttcaggaagct
gttaggagaatcaaagccgaacttggaaacaggcttgttgtgatcacggatatctgcatg
tgcgaattcacaagccacggccactgcggaatagtcgactttgaaactcaggaagtcctg
aatgaccccaccctggaagtcctgggaaaaattgctgtcagccacgcaagagccggagca
gatatggtagctccttcaggaatgatggacgggatggtaggtgcaatccgtatggctctt
gacgcaagcgggtttgagaatattcctattatgtcctatgccgcaaaatatcattcctgt
ttctacggtcctttcagagaagctgcagaatccggttattccttcggggaccgttcaacc
tatcagatggaccctgcaaacagtgacgaagctctcagggaagtagcccttgatgtggca
gaaggtgcggatattcttatggtgaagcccgggcttccgtatcttgatatcgtgtacagg
gtcaagagcgagttcggcatgccaacagccgcatacaatgtgagcggggaatattccatg
atcaaagccgcagcagccagcggctggattgatgagaaaaaggctatttacgagtccctt
atctccataaaaagggcaggtgcggatttcatcatcacctactttgcaaaggatgctgct
aggatgctgaaataa

DBGET integrated database retrieval system