KEGG   Methanosarcina mazei Go1: MM_2003Help
Entry
MM_2003           CDS       T00082                                 

Gene name
chlD
Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MM_2003 (chlD)
Enzymes [BR:mma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MM_2003 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386798..2388876
Genome map
AA seq 692 aa AA seqDB search
MKNHNIAVYPFTAIVGQEKMKKALVLNLINPKLGGVLVRGEKGTAKSTAVRALANLLPEI
EVVEGCKFKCNPQYQKELCEECLGKLNAGNLRVSRIKMKVVDLPVSATEDRVVGTLDIEH
AIKKGEKRFEPGVLAMAHRGILYVDEINLLDDHIVDVLLDSAAMGVNTVEREGISYSHPA
NFVLVGTMNPEEGELRPQLLDRFGLCVDVKGISDVSRRVELIKYRLSYEADPEGFAANWQ
AAETELCGQILTAKQLLSEVRISDDMLELISQICVDMGVDGHRADITMMKTSITLSAFNG
RADVLEEDVKEAAELVLSHRMRRKPFDSHSDKQDKLDESIEKHREKQKEKNKEKEQNRDQ
NNQEQQKQDRKENPEKTHEHPEGQQPENAQSNAEGQPDASSETIFATGESYQIKQLAPEF
IRADRKGSGRRSKTFTSSRQGRYIKSAIPHEKTTDLAFDATLRAAAPYQLTREKNGNSII
IHDPDLRKKIREKKIGNLVLFVVDASGSMGARQRMVASKGAVLSMLMDAYQKRDRVGLIA
FKGDSAELLLPPTSSIELAQKYLQEMPTGGKTPISRGLVKGYEIIKSELRRDPDTCPFMV
LISDGRANVSMNGEPPLHEIITIASRLKEEGIQSAVIDTESSMIKFGFAQQISTALGATY
LTLENLKADSIVNAVRASAPFEIMMHPGVSSV
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccataatattgctgtctatccctttaccgccatagtcgggcaggagaaaatg
aaaaaagcccttgtcctgaatctcattaaccctaaacttggcggagtccttgtcagaggg
gaaaaaggcactgccaaatcaacggcagtacgggcccttgcaaacctcctgcctgaaatc
gaagtcgttgagggctgtaaattcaaatgcaatcctcaatatcaaaaagaactgtgtgag
gaatgccttggaaaactaaatgcaggaaacctgagagtttcccggataaaaatgaaggta
gtggacctccccgtaagcgccaccgaggacagagttgtcggaacccttgatattgaacat
gctattaaaaaaggagaaaaacgttttgagccgggtgtgcttgcaatggctcacaggggc
atcctgtacgtggacgagatcaacctcctggatgaccacattgtagatgtacttcttgac
tctgcggcaatgggggtaaatactgttgagcgcgaagggatttcttactcccatcctgca
aactttgtgctcgtgggcaccatgaaccctgaggaaggggaactgcgtcctcagcttctt
gaccgtttcggcttatgtgtggatgtaaaaggcatcagtgatgtttccagaagggttgag
cttataaaatacaggctcagttacgaggcagaccctgagggctttgcagcaaactggcag
gctgccgaaaccgagctttgcggacagatcctcaccgcgaagcagcttctttccgaagtt
cggatttcggacgatatgcttgagctgatcagccagatctgcgttgatatgggtgttgac
gggcacagggcagacataacaatgatgaaaacctcaatcactctttcagcttttaacggg
agggctgacgttcttgaagaagacgtaaaagaagctgcagaacttgtgctttctcaccgc
atgcgcagaaaaccttttgattctcattccgacaaacaggataagctggatgaaagcatt
gaaaaacacagggaaaaacagaaagagaagaataaagagaaagagcaaaatagagatcaa
aataatcaggaacagcagaagcaggaccgtaaagaaaaccctgaaaaaactcacgaacac
ccggaagggcagcagccggaaaacgcacagagcaatgccgaagggcagcctgatgcctct
tcagaaactatttttgctacaggggaaagctatcagataaaacagcttgctcctgaattt
atcagggctgaccggaaagggtcgggcaggcgaagtaaaacctttaccagttccagacag
ggcaggtatataaagagtgcaattcctcatgaaaaaaccacagaccttgccttcgatgct
actctcagggcagctgctccttatcagctcacaagggaaaagaacggaaattccataata
attcatgatcctgacttaagaaaaaaaattcgtgagaaaaagattggcaaccttgtcctt
tttgtggtggatgccagcggttccatgggagccaggcagagaatggttgcgtccaaaggt
gcggtcctttccatgctgatggatgcttaccagaaacgggacagagtagggcttatcgca
tttaaaggagatagcgcagaactgttgctgcctccgacttccagtatagaactggctcaa
aaatatcttcaggagatgcccacgggagggaagactccgatttccagggggcttgtaaag
gggtatgagattataaaaagcgaactcaggcgtgaccctgacacctgcccttttatggtc
cttatctctgacggcagggcaaatgtaagcatgaacggcgaacctcctctccatgaaata
atcacaatagcatccaggttaaaggaggaaggcatccagtctgctgtaattgatacggaa
agcagtatgattaaatttgggtttgcacagcagatctccacagctcttggagctacctat
ctcactcttgaaaatttaaaagcggattctatagttaatgctgttagagcttcagccccg
tttgaaatcatgatgcatcccggcgtttcttcagtttga

DBGET integrated database retrieval system