KEGG   Methanosarcina mazei Go1: MM_2226Help
Entry
MM_2226           CDS       T00082                                 

Definition
glucoamylase (EC:3.2.1.3)
Organism
mma  Methanosarcina mazei Go1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653471..2654199
Genome map
AA seq 242 aa AA seqDB search
MDNRQVLQSSCNPRSQLPHKTIDRETGLPIPSFDLWEERKGVHTYSACTVYAGLKGACEL
ARSLGDYGNADIWKEAAVRLKEAIIEKLYDHKLGRFRRSLEEPDLDSSVFAVWYFGILPP
DDPRMVRTMEAIERELLRPSGGIARYLHDSYFGYMNSWIICTLWLSQWHSATGNLDRALE
LIKWCAVHAHPSGLMPEQVDNGGKPLSVLPLAWSHSAFVLAVLEYLQALDRREGGSCILP
EK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaggcaggtactacagagctcttgtaatccccgcagccagctacctcataaa
acaattgacagggaaacaggcctgccaattccaagttttgacctgtgggaagagagaaaa
ggcgtacatacttacagtgcctgtacggtctatgcggggctcaagggcgcctgtgagctt
gcccgctcccttggggattatggcaatgcagatatctggaaagaggctgcagtcaggtta
aaagaagccatcattgagaagctttacgaccataagctagggagattcaggcggtctctt
gaagagccagatcttgattcctctgtatttgcagtctggtatttcgggatcctccccccg
gatgaccccagaatggtaaggacaatggaagcaatagagcgcgaacttttgcgcccctca
ggcgggattgcaaggtatctccatgacagttactttggttatatgaacagctggattatc
tgcaccctctggctctctcaatggcattctgcaactgggaaccttgaccgcgctcttgag
cttattaaatggtgtgcagtccacgcccatccatcaggccttatgcccgagcaggtagat
aatgggggaaagcctctctccgtcctcccgcttgcatggtcacattcagcctttgtgctt
gcggtgcttgaatatcttcaggctcttgacaggagagaaggcggttcctgcattttgccg
gaaaaataa

DBGET integrated database retrieval system