KEGG   Methanosarcina mazei Go1: MM_2281Help
Entry
MM_2281           CDS       T00082                                 

Definition
hypothetical protein
Orthology
K09722  
4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MM_2281
Enzymes [BR:mma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     MM_2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2720047..2720808)
Genome map
AA seq 253 aa AA seqDB search
MTDIPHDHPRYESLLAREKVAAGVKMGITSIQGLIAQGRGESFDYLIGERSTESALYAER
AAVAALLLAENPVISVNGNVAALAPDKVVTLADITGARIEVNLFHRTDTRVHLIIEQLKA
SGAAEVLGKNPDASLELSHDRRLVSSKGIYTADVVLVPLEDGDRCEKLVEMGKTVITIDL
NPLSRTSKTATISIVDNLTRALGNMAKFAQEMKKERKEELVKLITTYDNKRTLSEAISEI
QEHLKTMAAETGY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacagatataccgcacgaccacccgaggtacgaatccctgctcgcccgtgaaaaagtt
gcagcaggggtaaaaatgggaattacaagtatccagggacttattgcccagggtagaggc
gagagttttgattaccttattggtgaaagaagcacagagtccgccctgtatgcagagagg
gctgcagttgctgcgcttctcctcgctgagaatccggtaatttcagtaaatggtaatgtt
gcagccctggcacctgataaagtagttacccttgcagatatcaccggagccaggattgaa
gtaaaccttttccacaggactgacacacgggtacatctcataatagaacagctgaaagca
agcggggctgctgaggtgcttggaaagaacccggatgcgagccttgaactctcacacgac
agaaggcttgtgagcagcaaagggatctataccgcagatgtcgtgctcgtccccctggaa
gacggagaccgctgcgagaagcttgtagagatgggaaagactgtgataacaatcgacctg
aaccctctttcacggacctcgaaaacagccacgatatctattgttgacaaccttacgcga
gcccttggaaatatggcaaaattcgcgcaggaaatgaaaaaggaaaggaaagaagagctt
gtgaagctgataaccacctatgataataaaaggaccctttccgaagcgatttccgaaatc
caggaacacctcaagaccatggccgcagaaacagggtactga

DBGET integrated database retrieval system