KEGG   Methanosarcina mazei Go1: MM_2281Help
Entry
MM_2281           CDS       T00082                                 

Definition
hypothetical protein
Orthology
K09722  
4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:mma00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2720047..2720808)
Genome map
AA seq 253 aa AA seqDB search
MTDIPHDHPRYESLLAREKVAAGVKMGITSIQGLIAQGRGESFDYLIGERSTESALYAER
AAVAALLLAENPVISVNGNVAALAPDKVVTLADITGARIEVNLFHRTDTRVHLIIEQLKA
SGAAEVLGKNPDASLELSHDRRLVSSKGIYTADVVLVPLEDGDRCEKLVEMGKTVITIDL
NPLSRTSKTATISIVDNLTRALGNMAKFAQEMKKERKEELVKLITTYDNKRTLSEAISEI
QEHLKTMAAETGY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacagatataccgcacgaccacccgaggtacgaatccctgctcgcccgtgaaaaagtt
gcagcaggggtaaaaatgggaattacaagtatccagggacttattgcccagggtagaggc
gagagttttgattaccttattggtgaaagaagcacagagtccgccctgtatgcagagagg
gctgcagttgctgcgcttctcctcgctgagaatccggtaatttcagtaaatggtaatgtt
gcagccctggcacctgataaagtagttacccttgcagatatcaccggagccaggattgaa
gtaaaccttttccacaggactgacacacgggtacatctcataatagaacagctgaaagca
agcggggctgctgaggtgcttggaaagaacccggatgcgagccttgaactctcacacgac
agaaggcttgtgagcagcaaagggatctataccgcagatgtcgtgctcgtccccctggaa
gacggagaccgctgcgagaagcttgtagagatgggaaagactgtgataacaatcgacctg
aaccctctttcacggacctcgaaaacagccacgatatctattgttgacaaccttacgcga
gcccttggaaatatggcaaaattcgcgcaggaaatgaaaaaggaaaggaaagaagagctt
gtgaagctgataaccacctatgataataaaaggaccctttccgaagcgatttccgaaatc
caggaacacctcaagaccatggccgcagaaacagggtactga

DBGET integrated database retrieval system