KEGG   Methanosarcina mazei Go1: MM_2358Help
Entry
MM_2358           CDS       T00082                                 

Definition
6-phosphofructokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MM_2358
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MM_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2815505..2816404
Genome map
AA seq 299 aa AA seqDB search
MDRIISVVGHTALDYIVDVENIAGKNESSPVIDYEEYPGGGAANIAVAIAKLGGKSQLIS
PVGTDFSSSGYEKLLKEAYVDLSRLYTIEDRKISKAFIFTDREDNQTTYFYWGASSKFKE
LEPEPVDFVHLATADCVYNAKIAQIAGFVSFDPGQDLVTYSKENLETILAHTDILFANKH
EIKRVSEMTGKSFSELRDMIDVIVVTYDAEGSIIYRGGDQWSIPVVSVKALDPTGAGDAY
RAGFLLAYTREYSLPTCGKIGSTVASFAVQSRGCQTSLPTWEEMKSRYEASFGNLGAEI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagaattatctccgttgtggggcatactgctcttgattatatcgtagatgtcgaa
aatatcgcaggaaaaaatgagtcttcccctgtaattgactatgaagaataccccggggga
ggggctgcaaatatcgcagttgcgattgcaaagctgggaggaaaaagccagctgatatct
cctgtaggtacggacttttcaagctcggggtatgaaaagcttcttaaagaggcatatgtt
gatctttcccgcctttatactattgaagacagaaaaatctccaaggctttcatttttacg
gacagggaagataaccagaccacatatttttactggggagcttcctcaaaattcaaagag
ctggaacctgaacctgtggattttgttcatcttgcaacagcggactgtgtctataatgca
aaaatagcgcagattgcaggttttgtatccttcgacccgggacaggaccttgtcacttat
tcaaaagaaaatcttgagacaattctcgcccacactgacattctttttgcaaacaagcat
gaaatcaaaagggtctcagagatgaccggaaagagtttttccgaactcagggatatgatt
gatgtcattgttgtcacttatgatgccgaaggcagcataatctacaggggcggtgaccag
tggtcaatccctgtagtttctgtaaaggctttggaccctacaggagcaggagacgcctac
agggcaggttttctgcttgcatacacaagagagtattcccttccaacctgtggaaaaatc
gggtcaacagtggcttcttttgccgtacagtcaaggggttgccagaccagtcttccgaca
tgggaagaaatgaagtcccgctacgaagccagttttggaaatctgggagcagaaatttaa

DBGET integrated database retrieval system