KEGG   Methanosarcina mazei Go1: MM_2358Help
Entry
MM_2358           CDS       T00082                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mma  Methanosarcina mazei Go1
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MM_2358
   00240 Pyrimidine metabolism
    MM_2358
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     MM_2358
    2.7.1.213  cytidine kinase
     MM_2358
    2.7.1.-  
     MM_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2815505..2816404
Genome map
AA seq 299 aa AA seqDB search
MDRIISVVGHTALDYIVDVENIAGKNESSPVIDYEEYPGGGAANIAVAIAKLGGKSQLIS
PVGTDFSSSGYEKLLKEAYVDLSRLYTIEDRKISKAFIFTDREDNQTTYFYWGASSKFKE
LEPEPVDFVHLATADCVYNAKIAQIAGFVSFDPGQDLVTYSKENLETILAHTDILFANKH
EIKRVSEMTGKSFSELRDMIDVIVVTYDAEGSIIYRGGDQWSIPVVSVKALDPTGAGDAY
RAGFLLAYTREYSLPTCGKIGSTVASFAVQSRGCQTSLPTWEEMKSRYEASFGNLGAEI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagaattatctccgttgtggggcatactgctcttgattatatcgtagatgtcgaa
aatatcgcaggaaaaaatgagtcttcccctgtaattgactatgaagaataccccggggga
ggggctgcaaatatcgcagttgcgattgcaaagctgggaggaaaaagccagctgatatct
cctgtaggtacggacttttcaagctcggggtatgaaaagcttcttaaagaggcatatgtt
gatctttcccgcctttatactattgaagacagaaaaatctccaaggctttcatttttacg
gacagggaagataaccagaccacatatttttactggggagcttcctcaaaattcaaagag
ctggaacctgaacctgtggattttgttcatcttgcaacagcggactgtgtctataatgca
aaaatagcgcagattgcaggttttgtatccttcgacccgggacaggaccttgtcacttat
tcaaaagaaaatcttgagacaattctcgcccacactgacattctttttgcaaacaagcat
gaaatcaaaagggtctcagagatgaccggaaagagtttttccgaactcagggatatgatt
gatgtcattgttgtcacttatgatgccgaaggcagcataatctacaggggcggtgaccag
tggtcaatccctgtagtttctgtaaaggctttggaccctacaggagcaggagacgcctac
agggcaggttttctgcttgcatacacaagagagtattcccttccaacctgtggaaaaatc
gggtcaacagtggcttcttttgccgtacagtcaaggggttgccagaccagtcttccgaca
tgggaagaaatgaagtcccgctacgaagccagttttggaaatctgggagcagaaatttaa

DBGET integrated database retrieval system