KEGG   Methanosarcina mazei Go1: MM_2683Help
Entry
MM_2683           CDS       T00082                                 

Definition
reverse transcriptase (EC:2.7.7.49)
Orthology
K00986  
RNA-directed DNA polymerase [EC:2.7.7.49]
Organism
mma  Methanosarcina mazei Go1
Brite
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     MM_2683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3207154..3208653
Genome map
AA seq 499 aa AA seqDB search
MNVREPEITSVTDLTDKELTQQWKIIDWKRVKEVVNNLQSRIASAAKSGNWKTVNKLSRL
LTRSFYAKLLSIRKVTTNKGSRTPGIDGIIWSSSADKMRAALQLTNKGYRAKPLTRKYIR
KKSGKLRPLSIPTMYDRAMQTLHSLVLGAIESAAGDKTSFGFKPYRSTKDAYAYLHLCLS
KKVSPEWIVEGDIKACFDEISHNWILDNIPIDKRILKEFLKAGYIENYHLFPTEKGTPQG
GPISPIIGNMSLNGLENALAMRFYSRSDGTIDKSHQNRRKVNYVRFADDLVVTADSPETA
LEIIDVIQAFLDPRGLKLSEEKTLVTNISEGFNFLGWNFRKYKGKLLPKPSKDSQKEIIK
KIRDVLHKAKAWDQDRLIQTLNPIIRGWAEYHNHAVSSAIFNKLDEIVYNMLISWAKRRH
SNKGFTWITTKYWHKSGKRKYVFCTELQTLERFSNAKIVRQRLASLNKNPFIDKEYFEQW
KFMEYHRKKRITNPNSVLN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagagaaccagagataacttcggttacggaccttacagacaaagaactcact
caacaatggaaaattattgattggaaaagagtgaaagaagtcgttaataacctacagtct
cgaattgcaagtgcagctaagagcggaaattggaaaaccgtgaacaaactctcccgtctt
ctgacccggtccttttatgccaaacttctttcgatacgtaaagtaaccactaacaaggga
agtcgaactcctggaattgatggcatcatttggtcatcgtcggcagataagatgcgtgcc
gctctacaactaacgaacaaaggctatcgtgcaaaaccattaacacggaagtacattcga
aagaagagcggtaaactacgacctcttagcataccaactatgtatgacagagcaatgcaa
actttgcactctctggtgttgggcgcaatcgaatctgcagcaggtgacaaaacttcgttt
gggtttaaaccttatcgttctacaaaagatgcttatgcctaccttcacctctgtttaagc
aagaaagtttctcctgaatggatcgttgaaggtgacattaaagcttgctttgatgaaatc
agccataactggatacttgataacatccctattgataaacgaatccttaaagagttccta
aaagccggatatatcgagaattatcatctgtttcctaccgaaaaaggcacacctcaagga
gggcctatatctccaataattggaaatatgtccttaaacggcttagaaaacgccttagcg
atgagattttactccagatcagatggaacaattgacaaatctcatcaaaacaggcgcaag
gttaattatgttcgttttgctgatgaccttgtggtaactgctgattccccggaaacggct
cttgaaataatcgacgtcatccaagcatttttagatcctcgtggacttaagctcagcgaa
gaaaagactcttgtgaccaatattagtgaagggttcaatttcctcggatggaacttcagg
aagtataaaggaaaactccttccgaagccatccaaagactctcaaaaggaaattatcaag
aaaatccgtgacgtacttcacaaagcaaaagcatgggatcaagaccgattgatacaaacc
ctcaacccaatcattaggggatgggcagagtatcataatcacgcagtttcttctgctatc
ttcaacaaacttgatgaaatagtctataacatgcttatctcctgggctaaaagaagacac
tcaaataaaggcttcacctggataacgaccaaatactggcataaatccggtaaaagaaaa
tacgtattctgcacagaactacagacgttggaaagattctccaatgccaaaattgttagg
caaagattagcaagccttaataagaatccatttatcgacaaagaatatttcgaacaatgg
aaattcatggagtaccaccggaagaaacgcatcactaaccccaattctgttctaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system