KEGG   Methanosarcina mazei Go1: MM_2779Help
Entry
MM_2779           CDS       T00082                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Organism
mma  Methanosarcina mazei Go1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3331814..3333247)
Genome map
AA seq 477 aa AA seqDB search
MPVTSSALTEVEVNPVNTPAGAVVLIVDGLSAPFIYPELTPHSLDGAVLEKARLENIPEI
SKNSAQILDFRAPQTFTEGGHSVLVTGNPDADSEFVSFKDANIFDILHAQGYLCIAVMEK
GDSWSICAEQDAVLRDKNNSIKNIEIMLEQYEYSQDIRVPSGLLQVMRSRADMAPAYVSS
KETRDRYNGYNRWGIETACDVVNYMAKNCPDQKYLLTVNVGAIDMSGHYRDNYGYIDCVE
SLDSELLPLYNLCKENSLAFILTADHGMAFSADGSKGGHQSEKYSVSDEAQMVPFIANAQ
DIESGVIRGEFGQEDFAPTLLGILDIPDRPRFVKGEQILLTGHVNLKVELPKKGSVELRR
NGQLISSSGNDDQFLFLGLDPDSYIVKAVLNSGNSPEEKEKEVYLRADSVLDFSNKEAKT
DESEYSPAEAKEKTSSASILGGGSIFDRSSKHLIGYLLIGTMNLAGLFFIMKIMKKD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgccagttacatcctccgctcttaccgaagtagaggtaaatcctgtgaatactccggca
ggggctgtagtattgatcgtggacggtttaagtgccccttttatctatcccgagcttaca
ccacattcacttgacggtgcagtccttgaaaaagcaaggcttgagaacatccctgaaatt
agtaaaaacagtgcacagattctcgacttccgcgcccctcagacttttaccgagggagga
cactccgtccttgttaccgggaatcctgatgcagacagcgagtttgtcagttttaaagat
gcaaatatttttgatattttacacgctcagggctacctttgcatcgcagtaatggaaaaa
ggagactcgtggtcaatctgtgcagagcaggacgctgtcctgagagacaagaacaactct
ataaaaaatatagagataatgcttgagcagtacgaatattctcaggatatcagggttcca
tccgggcttttacaggtaatgcggagtagagctgacatggctcctgcatatgtttcttcg
aaagagacaagagacaggtataacggatataacagatggggcatagaaacagcctgtgat
gtggtgaactatatggcaaaaaattgtcctgaccagaaatatctgcttactgtcaatgtg
ggggcaattgatatgagcgggcattacagggataattacgggtatatagactgtgttgaa
agcctcgactccgaacttctgcctctctataacctctgtaaagaaaacagccttgctttt
atcctgacagcagaccatggaatggctttttcggcagacggttccaaaggaggacaccag
tccgaaaaatattcggtttcggacgaggcacaaatggtccctttcatcgcaaacgcgcag
gacattgaaagtggggtcataagaggggagttcgggcaggaggattttgctcctacactg
ctcgggatactcgacatccctgacaggcccaggtttgtcaaaggagagcagatcctgctt
acagggcacgtaaacctgaaagttgaacttccaaaaaaagggtctgtggagctaaggaga
aatggacaactgatctcatcttcaggaaatgatgaccagtttcttttcctcgggcttgat
ccggattcctatattgtcaaagcagtcctgaactccggaaacagccctgaagaaaaggaa
aaagaggtttatctcagggccgattctgtactagatttctcaaataaagaggcaaaaaca
gatgaaagcgaatactctccggctgaagcaaaagaaaaaaccagctcggcaagcatcctg
ggaggaggatcaatttttgacaggagctcaaaacacctcataggatatcttctgattgga
acaatgaaccttgcagggctattcttcatcatgaaaattatgaaaaaagactga

DBGET integrated database retrieval system