KEGG   Methanosarcina mazei Go1: MM_2822Help
Entry
MM_2822           CDS       T00082                                 

Definition
(GenBank) Tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00260  Glycine, serine and threonine metabolism
mma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mma01100  Metabolic pathways
mma01110  Biosynthesis of secondary metabolites
mma01130  Biosynthesis of antibiotics
mma01230  Biosynthesis of amino acids
Module
mma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_2822
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MM_2822
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MM_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAM32518
UniProt: Q8PT95
Position
complement(3385449..3386594)
Genome map
AA seq 381 aa AA seqDB search
MPEVLMPALEELEEGYERYKNDPEFLAELDHYLRDFAGRETPLYLARNLSKKYGTKIYLK
REDLVHGGAHKLNNAIGQALLAKYMGKTRLIAETGAGQHGTATAMAGANLGFETVVYMGA
KDVKRQQMNAYRMELMGTEVKPVKTGSKTLKDAINEAFRDWVTNIGNTHYLIGSVVGPHP
YPMIVRDFQSVIGREVKEQAMEKEGRLPDTIIACAGGGSNAMGTFYPFIEDRDVRLIAVE
AGGKALRCTEKAALHSASLCAGEEGILHGARTKVLQDKNGQILESESVSAGLDYSGVGPE
LASLAESGRVTARYVTDDEAVEAFNELSRLEGIIPALESSHALAYLKKAAESGELGEFVV
VNLSGRGDKDLETVLSLKRGI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaagtcctcatgccggctctggaagagcttgaggaaggttatgagagatacaaa
aacgatcctgaattccttgcagaactcgaccactatctcagggattttgcgggcagagaa
actcctctttatcttgcccggaacctcagcaagaaatatgggacaaagatctacctcaag
agggaagaccttgtgcacggaggagcccacaagttaaacaacgccatagggcaggccctc
cttgcgaaatatatgggaaaaaccaggctgattgccgaaaccggagcaggacagcacggg
actgcaactgcaatggcaggggcaaacctggggtttgaaactgtcgtctacatgggggca
aaagatgtcaaacgacagcagatgaatgcatacagaatggaactcatgggaaccgaggta
aaacccgtaaagactggctcaaaaacactcaaggacgcgatcaacgaggctttcagggac
tgggttacgaacataggaaacacacattaccttataggctcggttgtgggtccccatccc
tatcccatgatcgtaagggacttccagagcgtaatagggcgggaagtaaaggagcaggca
atggaaaaagaaggcaggcttcccgacacaataatcgcctgcgcaggaggagggagcaat
gcaatggggactttctatccgtttatcgaagaccgggatgtcaggctgattgctgtggaa
gccggaggaaaagctttgagatgcacggaaaaagcagctcttcactcagcttccctctgc
gcaggagaagaaggaatcctgcatggggcaaggacaaaggttctgcaggacaaaaacggg
cagatccttgagtcagaatccgtgtctgccgggcttgactattcaggagtgggacctgaa
ctggcttccctggcagaaagcggcagggttacagcccgttacgtgacagacgacgaagca
gttgaagcttttaacgagctgagcaggcttgaagggattattcctgcccttgaatcctcc
catgcccttgcataccttaaaaaggctgctgaatcaggagaactcggggaatttgtggtt
gtaaacctttcaggacgaggggacaaagacctggaaaccgtactgagcctgaagagaggg
atatga

DBGET integrated database retrieval system