KEGG   Methanosarcina mazei Go1: MM_2822Help
Entry
MM_2822           CDS       T00082                                 

Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MM_2822
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_2822
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MM_2822
Enzymes [BR:mma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MM_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3385449..3386594)
Genome map
AA seq 381 aa AA seqDB search
MPEVLMPALEELEEGYERYKNDPEFLAELDHYLRDFAGRETPLYLARNLSKKYGTKIYLK
REDLVHGGAHKLNNAIGQALLAKYMGKTRLIAETGAGQHGTATAMAGANLGFETVVYMGA
KDVKRQQMNAYRMELMGTEVKPVKTGSKTLKDAINEAFRDWVTNIGNTHYLIGSVVGPHP
YPMIVRDFQSVIGREVKEQAMEKEGRLPDTIIACAGGGSNAMGTFYPFIEDRDVRLIAVE
AGGKALRCTEKAALHSASLCAGEEGILHGARTKVLQDKNGQILESESVSAGLDYSGVGPE
LASLAESGRVTARYVTDDEAVEAFNELSRLEGIIPALESSHALAYLKKAAESGELGEFVV
VNLSGRGDKDLETVLSLKRGI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaagtcctcatgccggctctggaagagcttgaggaaggttatgagagatacaaa
aacgatcctgaattccttgcagaactcgaccactatctcagggattttgcgggcagagaa
actcctctttatcttgcccggaacctcagcaagaaatatgggacaaagatctacctcaag
agggaagaccttgtgcacggaggagcccacaagttaaacaacgccatagggcaggccctc
cttgcgaaatatatgggaaaaaccaggctgattgccgaaaccggagcaggacagcacggg
actgcaactgcaatggcaggggcaaacctggggtttgaaactgtcgtctacatgggggca
aaagatgtcaaacgacagcagatgaatgcatacagaatggaactcatgggaaccgaggta
aaacccgtaaagactggctcaaaaacactcaaggacgcgatcaacgaggctttcagggac
tgggttacgaacataggaaacacacattaccttataggctcggttgtgggtccccatccc
tatcccatgatcgtaagggacttccagagcgtaatagggcgggaagtaaaggagcaggca
atggaaaaagaaggcaggcttcccgacacaataatcgcctgcgcaggaggagggagcaat
gcaatggggactttctatccgtttatcgaagaccgggatgtcaggctgattgctgtggaa
gccggaggaaaagctttgagatgcacggaaaaagcagctcttcactcagcttccctctgc
gcaggagaagaaggaatcctgcatggggcaaggacaaaggttctgcaggacaaaaacggg
cagatccttgagtcagaatccgtgtctgccgggcttgactattcaggagtgggacctgaa
ctggcttccctggcagaaagcggcagggttacagcccgttacgtgacagacgacgaagca
gttgaagcttttaacgagctgagcaggcttgaagggattattcctgcccttgaatcctcc
catgcccttgcataccttaaaaaggctgctgaatcaggagaactcggggaatttgtggtt
gtaaacctttcaggacgaggggacaaagacctggaaaccgtactgagcctgaagagaggg
atatga

DBGET integrated database retrieval system