KEGG   Methanosarcina mazei Go1: MM_2993Help
Entry
MM_2993           CDS       T00082                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mma  Methanosarcina mazei Go1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MM_2993
   01230 Biosynthesis of amino acids
    MM_2993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_2993
  Energy metabolism
   00680 Methane metabolism
    MM_2993
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MM_2993
Enzymes [BR:mma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MM_2993
Exosome [BR:mma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MM_2993
  Exosomal proteins of melanoma cells
   MM_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3617152..3617877)
Genome map
AA seq 241 aa AA seqDB search
MIITGHLILVRHGEPGLKPGERLSGWIDIPLSRKGIEEALECAKALENIEIDIAFASDLV
RTQETLFIILSGQKKTGVVVHEKTEDKVPPEKLDWYSYPEKLGEDLIPVYTTPALNERYY
GKLQGRKKQKMEEKYGAEQVANWRWNFEPGPPEGESLKAVYERTVPYFRKKVMPALEGGK
NVLICAHQSSLRALVKYIEDISDKDIREVRLSTGELAIYHFSEGKLVRENEELGPELKRN
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgataatcacgggtcatcttatacttgtcaggcatggagaacctggcctgaagccaggg
gaaaggctttcgggctggattgacatcccgttaagcaggaaaggcatagaagaagcactt
gaatgtgcgaaagcgcttgaaaacatagaaatagacattgcttttgcatcagaccttgtc
cgaacacaggaaacccttttcatcatactttcgggccagaaaaaaacaggggttgttgta
cacgagaaaacagaagataaagtgcccccggaaaagcttgactggtattcctaccccgaa
aagctcggagaagaccttatcccggtttatacgactcctgctctgaacgagcgttactac
ggcaaacttcagggcagaaaaaagcagaaaatggaagaaaaatacggtgcagaacaggta
gcaaactggcgctggaactttgaaccgggccctccggaaggggaaagcttgaaagctgtc
tatgagcgcacagttccctatttccgaaaaaaagtcatgcctgcccttgaaggaggaaaa
aatgtgctgatctgcgcccaccagagcagcctgagggctcttgtcaaatacatagaggat
atttccgacaaagatatcagggaagtaaggttgtccactggagagcttgcaatttaccat
ttttccgaaggaaaacttgtcagggaaaatgaagagctcggacctgagctgaaaaggaat
atttaa

DBGET integrated database retrieval system