KEGG   Methanosarcina mazei Go1: MM_3326Help
Entry
MM_3326           CDS       T00082                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mma  Methanosarcina mazei Go1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MM_3326
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MM_3326
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MM_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4053062..4054828)
Genome map
AA seq 588 aa AA seqDB search
MTTEKYAISGLTNVLYIDLSSQSYHIEERRDLYEKYLGGIGVATNLMLEEYKEGTGPLDP
EMPVILSTGPLSGVYPTCTKTVALFRSPLNGELGESYAGGHLAMSMRYSGYETIVIKGAS
RYPVYVAVHDDRVTFRDASSIWHLSSAIDVGKILREVEPGAGRRSIIRIGPAGERGITYA
SVNVDTYRHFGRLGLGTVFGAKKLKALLISGNKEIKSPDHKAYRKACSMLYDTIVKTGLT
EKYHNLGTSENILVLNELKGLPTRNLQETSIEGVENISGENFAEKYLIRRVSCAGCPIGC
VHIAMLKRPFSKAHEYETLNVSYDFELIYALGSNLGVTDPEAVLELIDACEKAGVDIISM
GVVLAWATEMLLRGKISTDDTLGLKLSWGDKASYLRAIELVVQAPNEFYSALGKGVEYAS
KIYGGEEFAIRIGGLEIPGYHTGLGNTLGLTVGSRHSHLDNAGYSADQKAFNHPTTDEKI
VDYIINEEDRRNALNSMVSCLFARNVYTYENMVLALKCIGIDRTEAELEDLGKDIFRKKY
ELKKKFGFSFEDIALPKRFFETATTTGKLEEDRVRKAIEMYKEKRGIL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagagaagtacgccatttcaggtcttacaaatgtactctatattgacctgagc
agccagagctaccatattgaggaaaggcgggacctctatgaaaagtatctggggggtatt
ggagttgctacaaacctcatgcttgaagagtataaagaaggaacaggtcctcttgaccct
gaaatgccagtaatcctcagcacaggccccctctcaggcgtatatccgacctgcacaaaa
actgttgcattatttcgttccccccttaatggagaactgggagaatcctatgcaggcggc
caccttgcaatgtccatgcgttattcgggatacgaaactattgtcatcaaaggtgcttct
aggtatccggtttatgtggcagttcacgacgacagggttacattcagggacgcctcgtcc
atatggcacctgtcctcggcaattgatgtggggaaaatcctccgcgaagtcgagcccgga
gcaggcaggcgcagtattatcaggatagggcctgcaggagaaagaggaatcacgtatgcg
agcgtcaatgttgacacttaccgccacttcgggcgtctggggctcgggactgtttttggg
gcaaaaaaactcaaagctcttcttatttccggaaataaagaaataaaaagccctgatcac
aaagcctacagaaaagcatgcagcatgctttatgatacaatagtgaaaaccgggttgact
gagaaataccacaacctcgggacaagcgaaaacatccttgtcctgaacgaactcaaaggt
cttccaacccggaacctgcaggaaacctctattgaaggcgtggaaaatatctccggagaa
aactttgcagaaaaatatctgatccgcagggtatcatgcgcaggctgccctataggctgc
gtacatattgccatgctcaaacggcctttctcaaaagcccatgaatatgagacccttaac
gtatcttatgactttgaacttatctacgcgcttggctcaaatcttggagttacggatcct
gaagcagtgctggaacttattgatgcctgtgaaaaagccggtgttgatattatcagcatg
ggagtggtgcttgcatgggctactgagatgcttttgcgggggaaaatttccactgatgat
acgctcgggctcaaactgtcctggggagacaaagcatcttatttgcgcgcaatagaactg
gtggttcaggctcccaatgaattttattccgctcttggaaaaggtgtggaatatgcttca
aaaatctatgggggggaagaatttgctatccggataggagggcttgagattccaggctac
catacagggcttgggaatacactcgggcttactgtaggttctcgccattcccatcttgac
aatgcaggctattcagctgaccagaaagcattcaatcatccaactacggatgagaagata
gttgattacataattaacgaagaagaccgccgcaatgcccttaactccatggtttcctgc
ctctttgcacggaatgtctatacatatgaaaatatggttctggctctcaaatgcattgga
atagacaggacagaagcagagctggaagatctgggaaaggacatcttcagaaaaaaatac
gagcttaagaaaaaattcgggttcagttttgaagacatcgccctccctaaaaggtttttt
gaaactgccaccaccacaggaaagctcgaagaagacagggtcaggaaagcgatagaaatg
tataaggaaaagagagggattttataa

DBGET integrated database retrieval system