KEGG   Modestobacter marinus: MODMU_0037Help
Entry
MODMU_0037        CDS       T02167                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmar  Modestobacter marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MODMU_0037 (pfkA)
   01230 Biosynthesis of amino acids
    MODMU_0037 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MODMU_0037 (pfkA)
   00030 Pentose phosphate pathway
    MODMU_0037 (pfkA)
   00051 Fructose and mannose metabolism
    MODMU_0037 (pfkA)
   00052 Galactose metabolism
    MODMU_0037 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MODMU_0037 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MODMU_0037 (pfkA)
Enzymes [BR:mmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MODMU_0037 (pfkA)
Protein phosphatases and associated proteins [BR:mmar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MODMU_0037 (pfkA)
Messenger RNA biogenesis [BR:mmar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MODMU_0037 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41403..42431)
Genome map
AA seq 342 aa AA seqDB search
MHIGVLTGGGDCPGLNAVLRSVVRTAEKEYGSTVVGFRNGWRGLLEDDAMVLDRPVVNGL
LTRGGTVLGSARVAPQKLRDGLGRMREVLDAHGVDALLPIGGEGTLTAAAWLASEGVPVI
GIPKTIDNDIHGTDLTFGFDTAVSIATDLIDRLHTTAESHQRVLLVEVMGRHAGWIALNA
GLASGAHLTITPEQPFDIEEVCKLVTARFDRGHRHVIGVVSEGATPLPGTMPLRDGGLDE
FGHRRFTGVAQQLGEELERRTGKEVRTTVLGHVQRGGTPTSFDRVLATRFGLHAAIAAHE
GHFGQMVALHGTEIGLVPLADAVRELKTVPKSRLAETASFTG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatcggagtgctgaccggcggcggcgactgccccggcctcaacgccgtcctgcgg
tccgtcgtccgcacggccgagaaggagtacggcagcaccgtcgtcgggttccgcaacggc
tggcgcggtctgctcgaggacgacgccatggtgctcgaccggccggtggtcaacgggctg
ctcacccgcggcggcacggtgctgggctcggcccgcgtcgcgccgcagaagctgcgggac
gggctcggccggatgcgcgaggtgctcgacgcccacggggtcgacgcgctgctgccgatc
gggggcgagggcacgctgaccgcggccgcgtggctggcgtcggagggcgtgccggtgatc
ggcatcccgaagacgatcgacaacgacatccacggcaccgacctgaccttcgggttcgac
accgcggtgagcatcgccaccgacctgatcgaccggctgcacaccaccgccgagtcgcac
cagcgggtgctgctggtcgaggtcatgggccggcacgccggctggatcgcgctcaacgcc
gggctcgcgtccggtgcgcacctgacgatcacccccgagcagcccttcgacatcgaggag
gtctgcaagctggtcaccgcccgcttcgaccgggggcaccggcacgtcatcggggtggtg
agcgagggcgccacgccgctgccgggcacgatgccgctccgcgacggcggcctggacgag
ttcggccaccggcggttcaccggcgtcgcgcagcagctgggcgaggagctcgagcggcgc
accggcaaggaggtgcggacgacggtgctcggccacgtgcagcgcggtggcaccccgacg
tccttcgaccgggtgctggccacccggttcggcctgcacgccgcgatcgccgcccatgag
ggccacttcgggcagatggtcgcgctgcacggcaccgagatcggcctcgtcccgctggcc
gacgccgtccgggagctcaagacggtccccaagtcccgcctcgccgagaccgcctccttc
accggctag

DBGET integrated database retrieval system