KEGG   Modestobacter marinus: MODMU_0220Help
Entry
MODMU_0220        CDS       T02167                                 

Gene name
mutM
Definition
(GenBank) DNA-(Apurinic or apyrimidinic site) lyase; Formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mmar  Modestobacter marinus
Pathway
mmar03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MODMU_0220 (mutM)
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MODMU_0220 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MODMU_0220 (mutM)
DNA repair and recombination proteins [BR:mmar03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MODMU_0220 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS zf-TFIIB Ribosomal_S13 DUF294_C FbpA Cys_rich_KTR zf-RRN7
Motif
Other DBs
NCBI-ProteinID: CCH85683
UniProt: I4EQM0
Position
217461..218330
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEALAAFLRENAVGRVVTRVDLAAVQAIKTFDPPLSALAGLELTGAMRHGKFLD
LDVSGLHLVVHLARAGWLHWRTNLPPAPPKPGKGPLAMRVHLEPREGELPEGFDLTEQGT
RKGLAVYVVRSPSEVPGIARLGPDALTVDTEQFGALLAGRHTQLKGTLTDQTVLAGIGNA
YSDEILHAAKLSPFKMADKVTDDELLRLHAAMRETLTGALDRQLGQRAATLKGEKRAGLQ
VHARTGLPCPVCGDTVREVSFADTSLQYCPTCQTGGKPLADRRMSKLLR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttgcccgaggtggaggccctggcggcgttcctgcgcgagaacgccgtcggc
cgtgtggtcacgcgcgtcgacctggccgccgtccaggcgatcaagaccttcgacccgccg
ctgtccgcgctggccgggctggagctcaccggtgccatgcggcacggcaagttcctcgac
ctcgacgtctccggtctgcacctggtcgtgcacctggcccgggccggctggctgcactgg
cgcaccaacctgccgccggctccgccgaagccgggcaaggggccgctggcgatgcgggtg
cacctcgagccgcgggagggggaactgccggagggcttcgacctgaccgagcagggcacc
cgcaaggggctggcggtctacgtcgtccggtcgccgtcggaggtgccggggatcgcccgg
ctcggcccggacgcgctgaccgtggacaccgagcagttcggcgcgctgctggccgggcgg
cacacccagctcaagggcacgctcaccgatcagaccgtgctcgccgggatcggcaacgcc
tactccgacgagatcctgcacgcggccaagctgtcgccgttcaagatggccgacaaggtc
accgacgacgagctgctccggctgcacgcggcgatgcgggagacgctgaccggtgcgctg
gaccggcagctcggccagcgggcggcgacgctcaagggcgagaagcgggccgggctgcag
gtgcacgcccgcaccgggctgccgtgcccggtctgcggggacaccgtccgcgaggtctcc
ttcgccgacacctcgctgcagtactgcccgacctgccagaccggcggcaagccgctcgcc
gaccgccggatgtccaagctgctgcgctga

DBGET integrated database retrieval system