KEGG   Modestobacter marinus: MODMU_0220Help
Entry
MODMU_0220        CDS       T02167                                 

Gene name
mutM
Definition
DNA-(Apurinic or apyrimidinic site) lyase; Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mmar  Modestobacter marinus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmar03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217461..218330
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEALAAFLRENAVGRVVTRVDLAAVQAIKTFDPPLSALAGLELTGAMRHGKFLD
LDVSGLHLVVHLARAGWLHWRTNLPPAPPKPGKGPLAMRVHLEPREGELPEGFDLTEQGT
RKGLAVYVVRSPSEVPGIARLGPDALTVDTEQFGALLAGRHTQLKGTLTDQTVLAGIGNA
YSDEILHAAKLSPFKMADKVTDDELLRLHAAMRETLTGALDRQLGQRAATLKGEKRAGLQ
VHARTGLPCPVCGDTVREVSFADTSLQYCPTCQTGGKPLADRRMSKLLR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttgcccgaggtggaggccctggcggcgttcctgcgcgagaacgccgtcggc
cgtgtggtcacgcgcgtcgacctggccgccgtccaggcgatcaagaccttcgacccgccg
ctgtccgcgctggccgggctggagctcaccggtgccatgcggcacggcaagttcctcgac
ctcgacgtctccggtctgcacctggtcgtgcacctggcccgggccggctggctgcactgg
cgcaccaacctgccgccggctccgccgaagccgggcaaggggccgctggcgatgcgggtg
cacctcgagccgcgggagggggaactgccggagggcttcgacctgaccgagcagggcacc
cgcaaggggctggcggtctacgtcgtccggtcgccgtcggaggtgccggggatcgcccgg
ctcggcccggacgcgctgaccgtggacaccgagcagttcggcgcgctgctggccgggcgg
cacacccagctcaagggcacgctcaccgatcagaccgtgctcgccgggatcggcaacgcc
tactccgacgagatcctgcacgcggccaagctgtcgccgttcaagatggccgacaaggtc
accgacgacgagctgctccggctgcacgcggcgatgcgggagacgctgaccggtgcgctg
gaccggcagctcggccagcgggcggcgacgctcaagggcgagaagcgggccgggctgcag
gtgcacgcccgcaccgggctgccgtgcccggtctgcggggacaccgtccgcgaggtctcc
ttcgccgacacctcgctgcagtactgcccgacctgccagaccggcggcaagccgctcgcc
gaccgccggatgtccaagctgctgcgctga

DBGET integrated database retrieval system