KEGG   Modestobacter marinus: MODMU_0310Help
Entry
MODMU_0310        CDS       T02167                                 

Gene name
folP
Definition
dihydropteroate synthase 2 (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mmar  Modestobacter marinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(314330..315190)
Genome map
AA seq 286 aa AA seqDB search
MLRIGPLDVPDGGLVVMAIVNRTPDSFYDRGATFGLDDALTRVDQVVAEGADMVDVGGVK
AAPGAEVDAAEEIRRTVDLVAAVRAAHPELPISIDTWRAEVAREALAAGAAVVNDAWGGV
DPQLAAVAAAAGAGIVCTHAGGLPPRTRPHRVSYDDVVADIVARTTALAEAAVAAGVDPE
RVLVDPGHDFGKNTRHSLQATRRLDELVATGWPVLVALSNKDFVGETLDLPVDQRLTGTL
AATAVSAWLGARVFRVHDVAATRQTLDMVASIRGDRPPARTTRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcatcggccccctcgacgtgcccgacggcgggctggtcgtgatggccatcgtc
aaccgcacccccgactcgttctacgaccgcggcgcgaccttcggcctggacgacgcgctg
acccgggtggaccaggtggtcgccgagggcgcggacatggtggacgtcggcggggtcaag
gccgcccccggcgcggaggtggacgccgccgaggagatccggcgcaccgtcgacctggtc
gccgccgtccgcgcggcccacccggagctgccgatctcgatcgacacctggcgcgcagag
gtggcccgggaggcgctggccgccggcgccgccgtggtcaacgacgcgtggggcggggtc
gacccgcagctggccgcggtcgccgcggcggcgggcgcgggcatcgtctgcacccacgcc
ggcggcctcccgccgcgcacccggccgcaccgggtcagctacgacgacgtggtggccgac
atcgtggcgcggacgacggcgctggccgaggccgcggtcgccgccggggtcgaccccgag
cgggtgctggtcgaccccggtcacgacttcggcaagaacacccgccactcgctgcaggcc
acccgccggctcgacgagctggtggccacgggctggccggtgctggtggcgctgtcgaac
aaggacttcgtcggcgagaccctcgacctgcccgtggaccagcggctcaccggcacgctc
gcggcgaccgcggtcagcgcctggctgggggcccgggtgttccgggtgcacgacgtggcg
gcgacccggcagacgctggacatggtggcctcgatccgcggtgaccggccaccggcccgc
accacccgcggcctggcctag

DBGET integrated database retrieval system