KEGG   Modestobacter marinus: MODMU_0557Help
Entry
MODMU_0557        CDS       T02167                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmar  Modestobacter marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MODMU_0557 (recR)
DNA repair and recombination proteins [BR:mmar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MODMU_0557 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559744..560340
Genome map
AA seq 198 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAAESADVGRLVAALQRVQAEVRFCVTCY
NVAEGEQCRICRDPRRSLDVICVVEEPKDVVAIERTREFKGRYHVLGGAISPIEGIGPDD
LRVKELMTRLMDGQVTELIIATDPNLEGEATAAYLARLVNPLGMEVSRLASGLPVGGDLE
YADEVTLGRAFEGRRRIA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcgctgtccaggacctcatcgacgagctcgggcggctgcccggcgtcggt
cccaagagcgcgcagcgcatcgccttccacctgctggccgccgagtcggccgacgtgggc
cggctcgtcgccgccctgcagcgggtgcaggccgaggtccgcttctgcgtgacctgctac
aacgtcgccgagggcgagcagtgccggatctgccgcgacccgcggcggtcgctcgacgtc
atctgcgtcgtcgaggagcccaaggacgtcgtggcgatcgagcgcacccgcgagttcaag
ggccggtaccacgtgctcggcggcgcgatcagcccgatcgagggcatcggccccgacgac
ctgcgggtcaaggagctgatgacccggctgatggacggtcaggtcaccgagctgatcatc
gccaccgaccccaacctcgagggcgaggcgaccgccgcctacctggcccggctggtcaac
ccgctgggcatggaggtctcccggctggccagcggcctgccggtcggcggtgacctcgag
tacgccgacgaggtcaccctgggccgcgccttcgagggccgccgccgcatcgcctga

DBGET integrated database retrieval system